Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8PCG3

Protein Details
Accession A8PCG3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cci:CC1G_05276  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSIFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQVSLKRCKHFELGGEKKTKGAALTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.89
5 0.87
6 0.89
7 0.89
8 0.88
9 0.88
10 0.88
11 0.89
12 0.85
13 0.87
14 0.86
15 0.81
16 0.75
17 0.72
18 0.62
19 0.56
20 0.53
21 0.53
22 0.52
23 0.5
24 0.53
25 0.52
26 0.56
27 0.58
28 0.6
29 0.55
30 0.56
31 0.61
32 0.59
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.45
63 0.39
64 0.33
65 0.31
66 0.3
67 0.35
68 0.41
69 0.44
70 0.47
71 0.57
72 0.64
73 0.7
74 0.67
75 0.61
76 0.58
77 0.53
78 0.53
79 0.53
80 0.53
81 0.54
82 0.57
83 0.54
84 0.5
85 0.48
86 0.42