Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1APY8

Protein Details
Accession A0A2V1APY8    Localization Confidence High Confidence Score 23.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SDLGFDPSLKKKKKSKKPTEEAEGGSHydrophilic
36-59DDMFAGLKKKKKSKKTDESGDSGAHydrophilic
70-92FDDLGLKKKKKKSTKAAGTSDFEHydrophilic
NLS Segment(s)
PositionSequence
11-19KKKKKSKKP
43-50KKKKKSKK
76-83KKKKKKST
Subcellular Location(s) nucl 18, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045196  IF2/IF5  
IPR002735  Transl_init_fac_IF2/IF5_dom  
IPR016189  Transl_init_fac_IF2/IF5_N  
IPR016190  Transl_init_fac_IF2/IF5_Zn-bd  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0005850  C:eukaryotic translation initiation factor 2 complex  
GO:0043614  C:multi-eIF complex  
GO:0005840  C:ribosome  
GO:0005525  F:GTP binding  
GO:1990856  F:methionyl-initiator methionine tRNA binding  
GO:0003729  F:mRNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0031369  F:translation initiation factor binding  
GO:0001731  P:formation of translation preinitiation complex  
Pfam View protein in Pfam  
PF01873  eIF-5_eIF-2B  
Amino Acid Sequences MSDLGFDPSLKKKKKSKKPTEEAEGGSPSPANAELDDMFAGLKKKKKSKKTDESGDSGASPSVDSVTASFDDLGLKKKKKKSTKAAGTSDFEQALEKAGLDDVTGAAPSDNQELPVQTTLGLPYDFLLSRFFTILKQNNPELAGDRSGPKFRIPPPVCQREGSKKTLFANVQEIATVLQRNPEHLIQFLFAELGTSGSIDGEKRLVLKGKFQPKQMESVLRRYIIEYVTCKTCKSMNTELKRESANRLHFLSCKACGSTRSVSSIKTGFQAQIGRRKRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.86
4 0.88
5 0.91
6 0.92
7 0.91
8 0.87
9 0.8
10 0.73
11 0.65
12 0.54
13 0.44
14 0.34
15 0.25
16 0.19
17 0.17
18 0.12
19 0.09
20 0.11
21 0.11
22 0.12
23 0.12
24 0.11
25 0.1
26 0.11
27 0.14
28 0.17
29 0.23
30 0.3
31 0.4
32 0.49
33 0.6
34 0.69
35 0.77
36 0.83
37 0.87
38 0.89
39 0.85
40 0.82
41 0.74
42 0.64
43 0.53
44 0.43
45 0.33
46 0.22
47 0.16
48 0.1
49 0.08
50 0.07
51 0.06
52 0.06
53 0.08
54 0.08
55 0.09
56 0.09
57 0.08
58 0.11
59 0.12
60 0.18
61 0.24
62 0.3
63 0.38
64 0.46
65 0.55
66 0.63
67 0.72
68 0.76
69 0.79
70 0.84
71 0.85
72 0.85
73 0.8
74 0.74
75 0.65
76 0.57
77 0.46
78 0.35
79 0.26
80 0.18
81 0.15
82 0.11
83 0.09
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.07
97 0.07
98 0.08
99 0.09
100 0.09
101 0.11
102 0.11
103 0.11
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.06
110 0.06
111 0.08
112 0.07
113 0.07
114 0.09
115 0.08
116 0.09
117 0.09
118 0.09
119 0.09
120 0.15
121 0.19
122 0.21
123 0.24
124 0.24
125 0.25
126 0.25
127 0.24
128 0.2
129 0.17
130 0.14
131 0.12
132 0.14
133 0.14
134 0.16
135 0.16
136 0.15
137 0.18
138 0.2
139 0.3
140 0.3
141 0.38
142 0.45
143 0.52
144 0.52
145 0.5
146 0.52
147 0.51
148 0.54
149 0.5
150 0.44
151 0.4
152 0.4
153 0.44
154 0.4
155 0.31
156 0.31
157 0.26
158 0.24
159 0.2
160 0.18
161 0.13
162 0.13
163 0.12
164 0.08
165 0.12
166 0.12
167 0.14
168 0.17
169 0.18
170 0.17
171 0.17
172 0.18
173 0.13
174 0.14
175 0.12
176 0.09
177 0.07
178 0.07
179 0.06
180 0.05
181 0.05
182 0.04
183 0.04
184 0.04
185 0.05
186 0.05
187 0.06
188 0.06
189 0.06
190 0.07
191 0.1
192 0.16
193 0.16
194 0.24
195 0.32
196 0.42
197 0.45
198 0.49
199 0.56
200 0.51
201 0.57
202 0.53
203 0.55
204 0.47
205 0.52
206 0.51
207 0.44
208 0.43
209 0.38
210 0.36
211 0.28
212 0.29
213 0.23
214 0.22
215 0.28
216 0.28
217 0.27
218 0.26
219 0.28
220 0.28
221 0.32
222 0.39
223 0.43
224 0.51
225 0.58
226 0.59
227 0.59
228 0.6
229 0.54
230 0.52
231 0.5
232 0.48
233 0.45
234 0.46
235 0.45
236 0.43
237 0.46
238 0.43
239 0.37
240 0.33
241 0.31
242 0.3
243 0.29
244 0.33
245 0.34
246 0.32
247 0.36
248 0.35
249 0.33
250 0.36
251 0.37
252 0.32
253 0.29
254 0.28
255 0.23
256 0.26
257 0.32
258 0.33
259 0.41