Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1AP31

Protein Details
Accession A0A2V1AP31    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
23-44FATPKAKRVKKIADDKKNDKAGHydrophilic
NLS Segment(s)
PositionSequence
28-34AKRVKKI
89-132GRPAKKWVRGSRQFKTFSGFKVKVKTWKHKGEPRAEKDKTEAKA
Subcellular Location(s) mito 12.5, cyto_mito 11.999, mito_nucl 9.832, cyto 9, cyto_nucl 8.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR013175  INO80_su_Ies4  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08193  INO80_Ies4  
Amino Acid Sequences MPPKRQLVKVKVSPEFLKTLPVFATPKAKRVKKIADDKKNDKAGDGKNSSPGPNDESASSRINTGMKEMSTAGLTVHSVNANFALDKSGRPAKKWVRGSRQFKTFSGFKVKVKTWKHKGEPRAEKDKTEAKAEAKAEAPKQEDTSESLPKHEHEEVDVGSETPSEATAITA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.42
4 0.42
5 0.34
6 0.31
7 0.26
8 0.28
9 0.26
10 0.25
11 0.35
12 0.28
13 0.36
14 0.44
15 0.48
16 0.49
17 0.56
18 0.64
19 0.63
20 0.73
21 0.76
22 0.77
23 0.81
24 0.82
25 0.82
26 0.79
27 0.69
28 0.6
29 0.57
30 0.52
31 0.52
32 0.49
33 0.41
34 0.4
35 0.41
36 0.4
37 0.35
38 0.31
39 0.25
40 0.23
41 0.23
42 0.18
43 0.19
44 0.22
45 0.22
46 0.2
47 0.17
48 0.16
49 0.17
50 0.15
51 0.15
52 0.13
53 0.11
54 0.12
55 0.12
56 0.11
57 0.1
58 0.1
59 0.07
60 0.06
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.07
72 0.06
73 0.07
74 0.1
75 0.16
76 0.17
77 0.18
78 0.27
79 0.32
80 0.41
81 0.5
82 0.54
83 0.58
84 0.68
85 0.74
86 0.72
87 0.73
88 0.68
89 0.59
90 0.56
91 0.47
92 0.41
93 0.43
94 0.39
95 0.34
96 0.37
97 0.39
98 0.43
99 0.49
100 0.56
101 0.56
102 0.62
103 0.68
104 0.7
105 0.75
106 0.77
107 0.79
108 0.77
109 0.78
110 0.7
111 0.63
112 0.61
113 0.6
114 0.51
115 0.45
116 0.41
117 0.33
118 0.37
119 0.36
120 0.34
121 0.3
122 0.32
123 0.3
124 0.32
125 0.33
126 0.29
127 0.3
128 0.29
129 0.27
130 0.27
131 0.29
132 0.31
133 0.29
134 0.29
135 0.29
136 0.29
137 0.34
138 0.32
139 0.28
140 0.23
141 0.26
142 0.24
143 0.25
144 0.25
145 0.19
146 0.16
147 0.16
148 0.13
149 0.1
150 0.1
151 0.07