Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1ASY3

Protein Details
Accession A0A2V1ASY3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-42GYLWKKAPRLSQPQKQRLRRRMQLVDRNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRSTLVAYGGYLWKKAPRLSQPQKQRLRRRMQLVDRNIEVLYQSLKQENSASTGYKKIDALKFDFPKENEMLTKDKYTAFDKKVRGYRKSVHFVPKWTKKSFRDHPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.2
5 0.24
6 0.27
7 0.32
8 0.35
9 0.46
10 0.55
11 0.62
12 0.69
13 0.76
14 0.82
15 0.85
16 0.87
17 0.86
18 0.86
19 0.85
20 0.83
21 0.83
22 0.82
23 0.81
24 0.77
25 0.72
26 0.63
27 0.56
28 0.47
29 0.37
30 0.27
31 0.18
32 0.13
33 0.09
34 0.1
35 0.1
36 0.11
37 0.11
38 0.12
39 0.12
40 0.14
41 0.13
42 0.14
43 0.13
44 0.16
45 0.15
46 0.15
47 0.16
48 0.18
49 0.19
50 0.21
51 0.24
52 0.29
53 0.31
54 0.32
55 0.36
56 0.31
57 0.32
58 0.31
59 0.28
60 0.22
61 0.22
62 0.23
63 0.22
64 0.23
65 0.2
66 0.21
67 0.22
68 0.26
69 0.3
70 0.32
71 0.36
72 0.39
73 0.46
74 0.52
75 0.57
76 0.57
77 0.56
78 0.6
79 0.62
80 0.66
81 0.65
82 0.67
83 0.63
84 0.67
85 0.7
86 0.72
87 0.7
88 0.69
89 0.72
90 0.68
91 0.75
92 0.77
93 0.78