Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1AW12

Protein Details
Accession A0A2V1AW12   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
155-174AEMRKKAKLEKLKQLKQSRTHydrophilic
NLS Segment(s)
PositionSequence
87-87K
90-90K
159-170KKAKLEKLKQLK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013268  U3_snoRNA_assoc  
Gene Ontology GO:0030515  F:snoRNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF08297  U3_snoRNA_assoc  
Amino Acid Sequences MPPRTRQASAKAKKITFTDDGELPEGASPVMVDDKSSDDAEQLKEQSESESDSDSDDAPEEESISASKAKSIKQQKEQEKREQELRKQEKQKRKEQDLIYQQQQQEKKKRLEEIMASSELPDLLPEELLEEYSQPTEDLPKGKHMRSEDLENEYAEMRKKAKLEKLKQLKQSRTSAIKKGPVHVQVQTFGEKKKSVPRADPKVVESKSSWLNRDSLRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.51
4 0.48
5 0.42
6 0.36
7 0.37
8 0.34
9 0.32
10 0.25
11 0.21
12 0.17
13 0.12
14 0.1
15 0.07
16 0.06
17 0.09
18 0.08
19 0.08
20 0.09
21 0.12
22 0.15
23 0.16
24 0.14
25 0.13
26 0.16
27 0.19
28 0.21
29 0.19
30 0.18
31 0.18
32 0.18
33 0.18
34 0.16
35 0.16
36 0.13
37 0.14
38 0.13
39 0.14
40 0.14
41 0.13
42 0.13
43 0.1
44 0.1
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.08
52 0.09
53 0.08
54 0.12
55 0.13
56 0.15
57 0.24
58 0.34
59 0.41
60 0.49
61 0.59
62 0.66
63 0.74
64 0.79
65 0.8
66 0.77
67 0.73
68 0.72
69 0.7
70 0.65
71 0.66
72 0.67
73 0.66
74 0.69
75 0.74
76 0.75
77 0.75
78 0.79
79 0.77
80 0.76
81 0.76
82 0.69
83 0.69
84 0.69
85 0.66
86 0.61
87 0.56
88 0.51
89 0.48
90 0.49
91 0.48
92 0.47
93 0.49
94 0.5
95 0.49
96 0.51
97 0.47
98 0.46
99 0.41
100 0.37
101 0.33
102 0.29
103 0.25
104 0.22
105 0.2
106 0.16
107 0.12
108 0.08
109 0.05
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.05
122 0.05
123 0.08
124 0.1
125 0.13
126 0.14
127 0.23
128 0.27
129 0.28
130 0.32
131 0.32
132 0.37
133 0.37
134 0.42
135 0.36
136 0.37
137 0.37
138 0.33
139 0.31
140 0.25
141 0.24
142 0.19
143 0.18
144 0.15
145 0.17
146 0.2
147 0.25
148 0.34
149 0.43
150 0.48
151 0.57
152 0.66
153 0.71
154 0.78
155 0.81
156 0.8
157 0.77
158 0.75
159 0.72
160 0.7
161 0.68
162 0.66
163 0.64
164 0.64
165 0.59
166 0.57
167 0.56
168 0.52
169 0.5
170 0.47
171 0.42
172 0.37
173 0.37
174 0.38
175 0.34
176 0.32
177 0.33
178 0.3
179 0.31
180 0.38
181 0.44
182 0.45
183 0.52
184 0.6
185 0.65
186 0.72
187 0.73
188 0.68
189 0.69
190 0.63
191 0.57
192 0.48
193 0.44
194 0.44
195 0.46
196 0.44
197 0.36
198 0.41
199 0.44