Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D6RPT9

Protein Details
Accession D6RPT9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-39EEGRQRKGINRFKKLQNDRRITKBasic
NLS Segment(s)
PositionSequence
19-29GRQRKGINRFK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
KEGG cci:CC1G_15221  -  
Amino Acid Sequences MDERTNESNARKEAKEEEGRQRKGINRFKKLQNDRRITKGQGDEKESCIQTMMQENGNGLSSSTVKREKSNGVSIYRGWYRPGLGSRDWTENFEIGLKSSRSESKTARSESKKDAWIGGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.5
4 0.56
5 0.6
6 0.63
7 0.61
8 0.62
9 0.6
10 0.61
11 0.65
12 0.63
13 0.62
14 0.67
15 0.73
16 0.78
17 0.82
18 0.82
19 0.82
20 0.81
21 0.76
22 0.75
23 0.72
24 0.63
25 0.59
26 0.57
27 0.54
28 0.49
29 0.51
30 0.45
31 0.44
32 0.46
33 0.39
34 0.31
35 0.25
36 0.2
37 0.16
38 0.18
39 0.16
40 0.13
41 0.13
42 0.13
43 0.12
44 0.13
45 0.11
46 0.07
47 0.07
48 0.07
49 0.07
50 0.11
51 0.14
52 0.14
53 0.16
54 0.19
55 0.23
56 0.26
57 0.32
58 0.33
59 0.31
60 0.32
61 0.31
62 0.33
63 0.31
64 0.27
65 0.22
66 0.19
67 0.18
68 0.2
69 0.23
70 0.22
71 0.21
72 0.25
73 0.27
74 0.32
75 0.32
76 0.31
77 0.29
78 0.25
79 0.24
80 0.22
81 0.19
82 0.14
83 0.18
84 0.16
85 0.15
86 0.18
87 0.23
88 0.24
89 0.29
90 0.31
91 0.35
92 0.43
93 0.48
94 0.55
95 0.56
96 0.59
97 0.62
98 0.65
99 0.62
100 0.56
101 0.52
102 0.45