Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B044

Protein Details
Accession A0A2V1B044    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
207-232HEYSKLDRWRKLQRRKLEKRLQGYGIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13cyto_nucl 13, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR016149  Casein_kin_II_reg-sub_N  
IPR035991  Casein_kinase_II_beta-like  
IPR000704  Casein_kinase_II_reg-sub  
Gene Ontology GO:0032545  C:CURI complex  
GO:0005956  C:protein kinase CK2 complex  
GO:0032040  C:small-subunit processome  
GO:0034456  C:UTP-C complex  
GO:0030291  F:protein serine/threonine kinase inhibitor activity  
GO:0006974  P:DNA damage response  
GO:0042790  P:nucleolar large rRNA transcription by RNA polymerase I  
GO:0006468  P:protein phosphorylation  
GO:0051726  P:regulation of cell cycle  
GO:0060962  P:regulation of ribosomal protein gene transcription by RNA polymerase II  
GO:0006356  P:regulation of transcription by RNA polymerase I  
GO:0006359  P:regulation of transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF01214  CK_II_beta  
PROSITE View protein in PROSITE  
PS01101  CK2_BETA  
Amino Acid Sequences MSHAAIHENGNDQLTDSSSDFSEYWIDLFLGIKGNEYFCDIDDDYIRDRFNLTGLNQEVSKIPTLVDIITDMADIEHQPEEHRDALEHNARILYGLIHARYILSQRGLNKMFEKYKNGDFGYCPRVHCHLHPLLPVGLSDQPRINSVKLYCAKCEDLYNPKSGRHAIVDGAYFGTSFPAMFFQNFPHAIPVHSRETYTPKVFGFRVHEYSKLDRWRKLQRRKLEKRLQGYGIEVNNTSGGFIAEDTKGDQAYQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.15
4 0.15
5 0.14
6 0.16
7 0.15
8 0.15
9 0.16
10 0.13
11 0.12
12 0.12
13 0.11
14 0.09
15 0.1
16 0.1
17 0.12
18 0.12
19 0.14
20 0.14
21 0.15
22 0.15
23 0.17
24 0.17
25 0.13
26 0.18
27 0.17
28 0.17
29 0.19
30 0.2
31 0.2
32 0.23
33 0.22
34 0.17
35 0.17
36 0.16
37 0.16
38 0.17
39 0.15
40 0.2
41 0.22
42 0.23
43 0.22
44 0.22
45 0.22
46 0.2
47 0.2
48 0.12
49 0.11
50 0.1
51 0.11
52 0.1
53 0.09
54 0.08
55 0.08
56 0.07
57 0.07
58 0.06
59 0.05
60 0.06
61 0.05
62 0.06
63 0.06
64 0.06
65 0.07
66 0.09
67 0.12
68 0.13
69 0.13
70 0.12
71 0.13
72 0.19
73 0.24
74 0.22
75 0.2
76 0.19
77 0.18
78 0.18
79 0.17
80 0.11
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.11
89 0.1
90 0.1
91 0.12
92 0.13
93 0.2
94 0.21
95 0.22
96 0.23
97 0.26
98 0.3
99 0.31
100 0.34
101 0.3
102 0.32
103 0.35
104 0.33
105 0.29
106 0.25
107 0.26
108 0.29
109 0.27
110 0.25
111 0.22
112 0.25
113 0.25
114 0.25
115 0.27
116 0.24
117 0.24
118 0.24
119 0.24
120 0.21
121 0.19
122 0.19
123 0.14
124 0.14
125 0.13
126 0.14
127 0.13
128 0.13
129 0.15
130 0.17
131 0.16
132 0.15
133 0.15
134 0.22
135 0.27
136 0.28
137 0.27
138 0.29
139 0.3
140 0.28
141 0.3
142 0.25
143 0.28
144 0.28
145 0.33
146 0.31
147 0.31
148 0.32
149 0.31
150 0.29
151 0.22
152 0.21
153 0.16
154 0.17
155 0.16
156 0.14
157 0.14
158 0.12
159 0.09
160 0.08
161 0.07
162 0.05
163 0.05
164 0.05
165 0.06
166 0.07
167 0.08
168 0.09
169 0.1
170 0.15
171 0.16
172 0.16
173 0.17
174 0.17
175 0.17
176 0.21
177 0.23
178 0.24
179 0.24
180 0.24
181 0.24
182 0.3
183 0.36
184 0.35
185 0.33
186 0.28
187 0.32
188 0.31
189 0.33
190 0.33
191 0.32
192 0.36
193 0.35
194 0.38
195 0.39
196 0.43
197 0.46
198 0.5
199 0.5
200 0.49
201 0.55
202 0.63
203 0.69
204 0.75
205 0.77
206 0.78
207 0.83
208 0.88
209 0.92
210 0.91
211 0.9
212 0.87
213 0.85
214 0.78
215 0.68
216 0.61
217 0.56
218 0.48
219 0.41
220 0.33
221 0.27
222 0.24
223 0.22
224 0.18
225 0.12
226 0.1
227 0.08
228 0.08
229 0.1
230 0.09
231 0.1
232 0.12
233 0.13
234 0.13