Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1AY11

Protein Details
Accession A0A2V1AY11   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
121-143SYYVKEPKERHFRKKEYAMNFFHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 12.833, nucl 5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR006885  NADH_UbQ_FeS_4_mit-like  
IPR038532  NDUFS4-like_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0070469  C:respirasome  
GO:0022900  P:electron transport chain  
Pfam View protein in Pfam  
PF04800  NDUS4  
Amino Acid Sequences MLSRGFARTQIRQFSRTVHSLQKPVLSDASTVKPNEIVSGAPEELTTSRTVRIFKEAKPATQSGRHNGKFWKLDWDVLGKENRWENDLIGYQSSGDYMQGTIMKFDTKEAAIRFAEGQGWSYYVKEPKERHFRKKEYAMNFFHSPGPLKHIRTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.46
4 0.44
5 0.43
6 0.44
7 0.46
8 0.47
9 0.46
10 0.41
11 0.39
12 0.37
13 0.29
14 0.25
15 0.24
16 0.26
17 0.25
18 0.24
19 0.22
20 0.21
21 0.2
22 0.2
23 0.17
24 0.13
25 0.1
26 0.14
27 0.13
28 0.11
29 0.11
30 0.11
31 0.11
32 0.12
33 0.12
34 0.09
35 0.11
36 0.14
37 0.15
38 0.15
39 0.23
40 0.25
41 0.25
42 0.35
43 0.34
44 0.34
45 0.36
46 0.37
47 0.32
48 0.36
49 0.37
50 0.35
51 0.43
52 0.42
53 0.41
54 0.41
55 0.44
56 0.39
57 0.37
58 0.37
59 0.28
60 0.28
61 0.26
62 0.27
63 0.21
64 0.22
65 0.23
66 0.15
67 0.17
68 0.18
69 0.18
70 0.17
71 0.16
72 0.14
73 0.15
74 0.16
75 0.14
76 0.12
77 0.11
78 0.1
79 0.09
80 0.09
81 0.06
82 0.05
83 0.05
84 0.04
85 0.06
86 0.08
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.1
93 0.11
94 0.09
95 0.13
96 0.14
97 0.17
98 0.16
99 0.18
100 0.18
101 0.16
102 0.18
103 0.14
104 0.15
105 0.11
106 0.13
107 0.12
108 0.12
109 0.16
110 0.19
111 0.22
112 0.28
113 0.32
114 0.4
115 0.51
116 0.58
117 0.65
118 0.71
119 0.75
120 0.78
121 0.83
122 0.82
123 0.8
124 0.8
125 0.74
126 0.7
127 0.65
128 0.57
129 0.5
130 0.44
131 0.39
132 0.31
133 0.34
134 0.34