Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8P353

Protein Details
Accession A8P353    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
142-167AYERLPSYQRKKIKAKRRAGRFSSLYHydrophilic
NLS Segment(s)
PositionSequence
151-161RKKIKAKRRAG
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG cci:CC1G_12398  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSRTATAAGPSTSAPNDGSRTITITNVPTNEGGDDIIPEEDGPVGTLRLRAARTRTGPRVTWDEDVVDNEHAGKKKSKICCIFRPTRDFGESSSSDSDSDSSCDHDHDREEGPSGEGSSSNRPRQGPMQIHDCCDSDDDKNAYERLPSYQRKKIKAKRRAGRFSSLYESQDAHTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.19
5 0.22
6 0.19
7 0.22
8 0.21
9 0.21
10 0.2
11 0.21
12 0.23
13 0.21
14 0.22
15 0.19
16 0.19
17 0.18
18 0.16
19 0.13
20 0.09
21 0.09
22 0.08
23 0.08
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.05
31 0.06
32 0.06
33 0.08
34 0.08
35 0.12
36 0.13
37 0.16
38 0.2
39 0.26
40 0.31
41 0.38
42 0.43
43 0.44
44 0.44
45 0.44
46 0.46
47 0.43
48 0.39
49 0.32
50 0.27
51 0.23
52 0.23
53 0.21
54 0.15
55 0.12
56 0.11
57 0.13
58 0.13
59 0.14
60 0.16
61 0.2
62 0.26
63 0.31
64 0.39
65 0.44
66 0.49
67 0.56
68 0.61
69 0.64
70 0.63
71 0.64
72 0.59
73 0.53
74 0.48
75 0.4
76 0.33
77 0.31
78 0.26
79 0.22
80 0.2
81 0.18
82 0.16
83 0.16
84 0.16
85 0.1
86 0.11
87 0.09
88 0.09
89 0.09
90 0.11
91 0.12
92 0.12
93 0.13
94 0.14
95 0.15
96 0.14
97 0.15
98 0.14
99 0.14
100 0.13
101 0.13
102 0.1
103 0.1
104 0.11
105 0.18
106 0.24
107 0.27
108 0.3
109 0.31
110 0.33
111 0.37
112 0.44
113 0.42
114 0.39
115 0.45
116 0.43
117 0.45
118 0.44
119 0.4
120 0.32
121 0.27
122 0.26
123 0.18
124 0.22
125 0.21
126 0.2
127 0.22
128 0.22
129 0.2
130 0.2
131 0.2
132 0.2
133 0.28
134 0.36
135 0.41
136 0.49
137 0.57
138 0.64
139 0.74
140 0.78
141 0.79
142 0.81
143 0.84
144 0.85
145 0.88
146 0.9
147 0.84
148 0.84
149 0.77
150 0.72
151 0.69
152 0.63
153 0.55
154 0.46
155 0.42