Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1AVA6

Protein Details
Accession A0A2V1AVA6    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-30SSMSVKIVKKYTKKFKRHHSDRYDRVAENHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MSSMSVKIVKKYTKKFKRHHSDRYDRVAENWRKQKGIDSCVRRRFRGTIRQPNIGYGSNKKTKFMNPSGYKVYLVRNVQDLDALLMHTKTHAAEIAHNVSSKNRVDIVTKAKSLGVKVTNPKGRVALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.86
4 0.89
5 0.9
6 0.9
7 0.9
8 0.9
9 0.88
10 0.88
11 0.82
12 0.71
13 0.65
14 0.65
15 0.62
16 0.61
17 0.62
18 0.55
19 0.5
20 0.5
21 0.54
22 0.5
23 0.5
24 0.49
25 0.49
26 0.56
27 0.65
28 0.68
29 0.61
30 0.58
31 0.57
32 0.56
33 0.57
34 0.59
35 0.6
36 0.61
37 0.66
38 0.62
39 0.58
40 0.54
41 0.46
42 0.38
43 0.31
44 0.33
45 0.34
46 0.34
47 0.33
48 0.32
49 0.33
50 0.38
51 0.38
52 0.41
53 0.37
54 0.41
55 0.44
56 0.43
57 0.39
58 0.33
59 0.31
60 0.27
61 0.24
62 0.21
63 0.2
64 0.2
65 0.19
66 0.18
67 0.15
68 0.1
69 0.09
70 0.09
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.08
79 0.08
80 0.11
81 0.16
82 0.19
83 0.2
84 0.2
85 0.2
86 0.2
87 0.24
88 0.23
89 0.2
90 0.19
91 0.19
92 0.21
93 0.27
94 0.33
95 0.34
96 0.34
97 0.32
98 0.33
99 0.33
100 0.32
101 0.33
102 0.29
103 0.31
104 0.38
105 0.47
106 0.52
107 0.51
108 0.52
109 0.49