Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1AUM7

Protein Details
Accession A0A2V1AUM7    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
130-156QTPQVNQPQRQNKKQHGKSKRTCSYCDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.833, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MSVVEVSKTVGQLAAAITQKSKELDLLKAEYESKLKILDEYITKVVPREEQRRENGSNEIDTCELLQKELRCSKCQNIVYSLKEETDYVLVPRKVAERKAADIPDLIQSLEKLETSVKSINAGSSRPLQQTPQVNQPQRQNKKQHGKSKRTCSYCDEPGHTRARCFARLSKEPGSEDTSRNRPAKSNHSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.16
5 0.16
6 0.18
7 0.18
8 0.18
9 0.18
10 0.18
11 0.22
12 0.25
13 0.27
14 0.26
15 0.27
16 0.27
17 0.24
18 0.24
19 0.2
20 0.17
21 0.16
22 0.15
23 0.14
24 0.14
25 0.16
26 0.17
27 0.2
28 0.21
29 0.2
30 0.2
31 0.2
32 0.2
33 0.23
34 0.28
35 0.32
36 0.38
37 0.44
38 0.5
39 0.56
40 0.57
41 0.53
42 0.5
43 0.43
44 0.38
45 0.32
46 0.28
47 0.21
48 0.19
49 0.17
50 0.16
51 0.13
52 0.12
53 0.14
54 0.13
55 0.19
56 0.26
57 0.28
58 0.28
59 0.32
60 0.36
61 0.41
62 0.43
63 0.39
64 0.39
65 0.41
66 0.4
67 0.39
68 0.35
69 0.27
70 0.24
71 0.22
72 0.16
73 0.12
74 0.1
75 0.08
76 0.13
77 0.13
78 0.13
79 0.13
80 0.17
81 0.18
82 0.19
83 0.25
84 0.21
85 0.24
86 0.28
87 0.28
88 0.24
89 0.22
90 0.22
91 0.18
92 0.16
93 0.13
94 0.09
95 0.08
96 0.09
97 0.09
98 0.08
99 0.06
100 0.07
101 0.07
102 0.1
103 0.12
104 0.11
105 0.12
106 0.12
107 0.14
108 0.15
109 0.15
110 0.14
111 0.16
112 0.2
113 0.2
114 0.21
115 0.2
116 0.25
117 0.32
118 0.33
119 0.39
120 0.45
121 0.47
122 0.51
123 0.59
124 0.64
125 0.65
126 0.71
127 0.7
128 0.71
129 0.78
130 0.83
131 0.84
132 0.84
133 0.86
134 0.87
135 0.89
136 0.88
137 0.81
138 0.76
139 0.73
140 0.7
141 0.67
142 0.63
143 0.57
144 0.53
145 0.54
146 0.59
147 0.53
148 0.46
149 0.45
150 0.45
151 0.43
152 0.44
153 0.44
154 0.45
155 0.5
156 0.57
157 0.57
158 0.56
159 0.54
160 0.53
161 0.53
162 0.48
163 0.45
164 0.46
165 0.46
166 0.49
167 0.5
168 0.49
169 0.49
170 0.53