Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1AYJ5

Protein Details
Accession A0A2V1AYJ5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
330-349PMYHIKGKKKHELSKTEQEEBasic
NLS Segment(s)
PositionSequence
119-121RVK
125-133ALVKKEKKG
Subcellular Location(s) plas 19, mito 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004923  FTR1/Fip1/EfeU  
Gene Ontology GO:0033573  C:high-affinity iron permease complex  
GO:0061840  F:high-affinity ferrous iron transmembrane transporter activity  
GO:0033215  P:reductive iron assimilation  
Pfam View protein in Pfam  
PF03239  FTR1  
Amino Acid Sequences MVDVFNVQIFFVVFRETLEAVVVVSVLLAFLKQGLGGSTDDPVVYKKLKRQVWLGAILGVVICLILGCAFIGAFYSLGKDIWASSEDLWEGIFCIIATVLISLMGIAMLRINKMKEKWRVKLAQALVKKEKKGRFSLGQWAKKYALFILPFITCLREGLEAIVFVGGVGLNSPATSFPIPVITGLLAGILVGVLLYYSGSTMSLQIFLIISTCILYLIAAGLFSRGVWFFETYVYNNKTGGDASENGSGPGTYDISKSVWHVNCCNPETDNGWDVFNSLLGWQNSATYGSVLSYNIYWIVVIVVLMLMMYEEKTGHLPFAKNLTLRSLNPMYHIKGKKKHELSKTEQEELFARVRHQDMAGEDEDSSESIAHKAVEGGEKNATTEQTRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.14
3 0.13
4 0.13
5 0.13
6 0.12
7 0.1
8 0.1
9 0.09
10 0.05
11 0.05
12 0.04
13 0.03
14 0.03
15 0.03
16 0.03
17 0.04
18 0.04
19 0.04
20 0.05
21 0.06
22 0.08
23 0.09
24 0.1
25 0.11
26 0.11
27 0.11
28 0.11
29 0.13
30 0.15
31 0.19
32 0.22
33 0.29
34 0.37
35 0.42
36 0.46
37 0.5
38 0.54
39 0.55
40 0.55
41 0.49
42 0.41
43 0.36
44 0.32
45 0.25
46 0.16
47 0.1
48 0.05
49 0.04
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.1
70 0.1
71 0.1
72 0.12
73 0.12
74 0.12
75 0.11
76 0.09
77 0.09
78 0.07
79 0.07
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.02
94 0.04
95 0.05
96 0.06
97 0.08
98 0.1
99 0.15
100 0.19
101 0.27
102 0.36
103 0.44
104 0.49
105 0.56
106 0.6
107 0.58
108 0.62
109 0.59
110 0.56
111 0.53
112 0.54
113 0.55
114 0.54
115 0.56
116 0.56
117 0.56
118 0.53
119 0.54
120 0.53
121 0.5
122 0.48
123 0.55
124 0.57
125 0.59
126 0.55
127 0.53
128 0.48
129 0.42
130 0.4
131 0.3
132 0.26
133 0.19
134 0.18
135 0.17
136 0.16
137 0.16
138 0.16
139 0.15
140 0.1
141 0.1
142 0.1
143 0.08
144 0.08
145 0.08
146 0.08
147 0.07
148 0.07
149 0.07
150 0.05
151 0.04
152 0.04
153 0.03
154 0.02
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.05
162 0.06
163 0.06
164 0.06
165 0.07
166 0.07
167 0.07
168 0.08
169 0.06
170 0.05
171 0.05
172 0.05
173 0.03
174 0.03
175 0.03
176 0.02
177 0.02
178 0.01
179 0.01
180 0.01
181 0.01
182 0.01
183 0.02
184 0.02
185 0.02
186 0.03
187 0.03
188 0.04
189 0.04
190 0.05
191 0.05
192 0.06
193 0.06
194 0.05
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.04
212 0.04
213 0.05
214 0.06
215 0.07
216 0.07
217 0.09
218 0.11
219 0.11
220 0.18
221 0.2
222 0.19
223 0.19
224 0.19
225 0.17
226 0.16
227 0.16
228 0.11
229 0.11
230 0.12
231 0.16
232 0.16
233 0.15
234 0.15
235 0.14
236 0.12
237 0.12
238 0.1
239 0.07
240 0.08
241 0.09
242 0.09
243 0.1
244 0.11
245 0.18
246 0.2
247 0.22
248 0.26
249 0.3
250 0.36
251 0.37
252 0.37
253 0.29
254 0.28
255 0.29
256 0.29
257 0.25
258 0.19
259 0.18
260 0.17
261 0.16
262 0.14
263 0.12
264 0.08
265 0.06
266 0.11
267 0.11
268 0.12
269 0.12
270 0.12
271 0.12
272 0.13
273 0.13
274 0.07
275 0.07
276 0.07
277 0.08
278 0.08
279 0.08
280 0.07
281 0.07
282 0.07
283 0.07
284 0.06
285 0.05
286 0.05
287 0.05
288 0.04
289 0.04
290 0.03
291 0.03
292 0.03
293 0.03
294 0.03
295 0.03
296 0.03
297 0.04
298 0.04
299 0.05
300 0.08
301 0.08
302 0.1
303 0.14
304 0.15
305 0.17
306 0.23
307 0.26
308 0.25
309 0.26
310 0.31
311 0.31
312 0.31
313 0.36
314 0.35
315 0.31
316 0.34
317 0.38
318 0.36
319 0.41
320 0.48
321 0.49
322 0.54
323 0.61
324 0.67
325 0.72
326 0.77
327 0.77
328 0.78
329 0.78
330 0.81
331 0.79
332 0.75
333 0.66
334 0.59
335 0.51
336 0.46
337 0.41
338 0.32
339 0.27
340 0.26
341 0.27
342 0.27
343 0.26
344 0.25
345 0.22
346 0.26
347 0.26
348 0.22
349 0.2
350 0.19
351 0.19
352 0.16
353 0.14
354 0.09
355 0.09
356 0.09
357 0.1
358 0.09
359 0.09
360 0.11
361 0.13
362 0.2
363 0.21
364 0.23
365 0.26
366 0.26
367 0.27
368 0.28
369 0.28
370 0.23