Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1AMH2

Protein Details
Accession A0A2V1AMH2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-48LNVPKTRRTYCKGKDCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MKIKVPSKDIPLKSKQQDLLNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVVCKTKAQLALKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.63
3 0.58
4 0.6
5 0.58
6 0.61
7 0.6
8 0.61
9 0.55
10 0.56
11 0.55
12 0.53
13 0.54
14 0.5
15 0.52
16 0.56
17 0.66
18 0.7
19 0.75
20 0.8
21 0.81
22 0.85
23 0.85
24 0.86
25 0.85
26 0.85
27 0.83
28 0.84
29 0.86
30 0.78
31 0.77
32 0.7
33 0.65
34 0.57
35 0.51
36 0.4
37 0.32
38 0.3
39 0.3
40 0.29
41 0.26
42 0.31
43 0.35
44 0.38
45 0.43
46 0.47
47 0.43
48 0.5
49 0.57
50 0.54
51 0.56
52 0.55
53 0.55
54 0.54
55 0.57
56 0.48
57 0.44
58 0.41
59 0.34
60 0.37
61 0.39
62 0.38
63 0.33
64 0.4
65 0.44
66 0.52
67 0.61
68 0.64
69 0.63
70 0.67
71 0.74
72 0.74
73 0.73
74 0.68
75 0.63
76 0.6
77 0.57
78 0.51
79 0.44
80 0.4
81 0.34
82 0.29
83 0.27
84 0.26
85 0.3
86 0.35
87 0.38
88 0.43
89 0.53
90 0.61
91 0.66
92 0.64
93 0.59
94 0.56
95 0.51
96 0.5
97 0.5
98 0.51
99 0.53
100 0.6
101 0.58
102 0.59
103 0.61
104 0.58