Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1AR63

Protein Details
Accession A0A2V1AR63   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-50TKEHSFKQYPPKPRTYKRYKTSKQLITDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MSDSGSQTPSDNTEAHQLSYITTKEHSFKQYPPKPRTYKRYKTSKQLITDEIRYLQSKKLGIDTPTWTSVVAPPSLKPQKHYCDITGLEGKYKSPANALRFHNVEIYQEVIKHMPPGVDQEYLSLRGANVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.22
5 0.2
6 0.24
7 0.23
8 0.16
9 0.17
10 0.19
11 0.19
12 0.24
13 0.3
14 0.29
15 0.34
16 0.44
17 0.51
18 0.58
19 0.62
20 0.67
21 0.7
22 0.76
23 0.8
24 0.8
25 0.82
26 0.81
27 0.86
28 0.82
29 0.83
30 0.83
31 0.8
32 0.76
33 0.69
34 0.65
35 0.58
36 0.54
37 0.45
38 0.37
39 0.31
40 0.27
41 0.24
42 0.21
43 0.2
44 0.19
45 0.18
46 0.2
47 0.2
48 0.2
49 0.22
50 0.23
51 0.22
52 0.22
53 0.21
54 0.18
55 0.15
56 0.16
57 0.14
58 0.13
59 0.11
60 0.1
61 0.19
62 0.26
63 0.26
64 0.27
65 0.33
66 0.37
67 0.42
68 0.44
69 0.36
70 0.36
71 0.36
72 0.37
73 0.35
74 0.3
75 0.27
76 0.25
77 0.24
78 0.21
79 0.22
80 0.18
81 0.18
82 0.24
83 0.25
84 0.32
85 0.36
86 0.38
87 0.39
88 0.39
89 0.38
90 0.32
91 0.29
92 0.23
93 0.22
94 0.17
95 0.16
96 0.17
97 0.14
98 0.14
99 0.14
100 0.14
101 0.12
102 0.12
103 0.18
104 0.19
105 0.2
106 0.2
107 0.21
108 0.23
109 0.24
110 0.24
111 0.19
112 0.15
113 0.15