Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2X1X3

Protein Details
Accession A0A1Y2X1X3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-128TAEGSKRRGKDRRIHNSRRPYDDKKGGEBasic
NLS Segment(s)
PositionSequence
103-132EGSKRRGKDRRIHNSRRPYDDKKGGEMSRK
Subcellular Location(s) nucl 9.5, cyto_nucl 9.5, mito 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MASPPMNKYWIPHLDIHKKVITQELQYYLGPDATVRPYTREGEDGFLIQTPGPCLTDEQIDDICLKSKEMWEKQAAARSQLNPEKPLKRPLHQPILISRGTAEGSKRRGKDRRIHNSRRPYDDKKGGEMSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.54
3 0.56
4 0.5
5 0.46
6 0.43
7 0.44
8 0.38
9 0.31
10 0.32
11 0.31
12 0.3
13 0.29
14 0.3
15 0.23
16 0.2
17 0.17
18 0.13
19 0.11
20 0.12
21 0.16
22 0.14
23 0.17
24 0.2
25 0.22
26 0.23
27 0.23
28 0.21
29 0.21
30 0.21
31 0.18
32 0.15
33 0.14
34 0.13
35 0.1
36 0.09
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.09
43 0.1
44 0.1
45 0.11
46 0.1
47 0.1
48 0.1
49 0.09
50 0.11
51 0.09
52 0.09
53 0.08
54 0.11
55 0.18
56 0.2
57 0.23
58 0.23
59 0.26
60 0.28
61 0.33
62 0.31
63 0.27
64 0.28
65 0.26
66 0.31
67 0.33
68 0.33
69 0.3
70 0.36
71 0.38
72 0.38
73 0.47
74 0.44
75 0.44
76 0.51
77 0.56
78 0.6
79 0.57
80 0.56
81 0.51
82 0.51
83 0.47
84 0.38
85 0.3
86 0.21
87 0.2
88 0.19
89 0.18
90 0.19
91 0.26
92 0.33
93 0.36
94 0.44
95 0.51
96 0.58
97 0.64
98 0.68
99 0.73
100 0.77
101 0.84
102 0.85
103 0.88
104 0.87
105 0.87
106 0.85
107 0.81
108 0.81
109 0.8
110 0.74
111 0.69
112 0.7