Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N317

Protein Details
Accession A8N317    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
249-275KTSTTPSSTPRQRKLRLSFTLRPKRNSHydrophilic
NLS Segment(s)
PositionSequence
100-122RSSSKLRALPRSPRVPPPTPMRR
Subcellular Location(s) nucl 19, cyto 6.5, cyto_mito 4
Family & Domain DBs
KEGG cci:CC1G_06589  -  
Amino Acid Sequences MPVCQFYLTKCSESLLDLGWKIIMPKRNPVNSADDSNSPPKDNSDPLSVFLIISAKAYSSIGFGLSVLAIWMRWFLPDSAAPGQPVKAIANMPSPGPKTRSSSKLRALPRSPRVPPPTPMRRRSAPPTTTYSPVSILEHGSAPPSHSREPSGSSRRVYFADMQAPVSRRNTEPLERLTFVPEEETQMPTPIPSVPPSPLILSPILIESPLLTSLPVTNMVTPTPITTVAQDTPSTTINDENFTQPENEKTSTTPSSTPRQRKLRLSFTLRPKRNSLDKSREDPVVSQGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.19
3 0.2
4 0.18
5 0.18
6 0.17
7 0.17
8 0.18
9 0.22
10 0.26
11 0.25
12 0.34
13 0.43
14 0.48
15 0.5
16 0.51
17 0.53
18 0.5
19 0.53
20 0.47
21 0.41
22 0.4
23 0.45
24 0.43
25 0.37
26 0.34
27 0.32
28 0.33
29 0.34
30 0.32
31 0.33
32 0.32
33 0.32
34 0.34
35 0.3
36 0.25
37 0.22
38 0.2
39 0.12
40 0.12
41 0.1
42 0.07
43 0.08
44 0.08
45 0.08
46 0.07
47 0.08
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.07
62 0.07
63 0.1
64 0.11
65 0.15
66 0.18
67 0.18
68 0.19
69 0.18
70 0.18
71 0.16
72 0.17
73 0.13
74 0.11
75 0.11
76 0.12
77 0.15
78 0.15
79 0.15
80 0.18
81 0.2
82 0.21
83 0.23
84 0.25
85 0.26
86 0.31
87 0.39
88 0.42
89 0.47
90 0.51
91 0.56
92 0.59
93 0.62
94 0.62
95 0.63
96 0.64
97 0.64
98 0.6
99 0.61
100 0.62
101 0.57
102 0.56
103 0.57
104 0.6
105 0.61
106 0.63
107 0.6
108 0.57
109 0.59
110 0.61
111 0.61
112 0.53
113 0.48
114 0.5
115 0.47
116 0.46
117 0.42
118 0.35
119 0.27
120 0.25
121 0.22
122 0.15
123 0.13
124 0.11
125 0.1
126 0.09
127 0.09
128 0.08
129 0.09
130 0.11
131 0.13
132 0.14
133 0.14
134 0.16
135 0.16
136 0.2
137 0.27
138 0.31
139 0.31
140 0.31
141 0.32
142 0.32
143 0.32
144 0.3
145 0.24
146 0.21
147 0.21
148 0.21
149 0.21
150 0.22
151 0.22
152 0.22
153 0.22
154 0.21
155 0.17
156 0.21
157 0.23
158 0.24
159 0.27
160 0.29
161 0.31
162 0.31
163 0.31
164 0.29
165 0.25
166 0.22
167 0.2
168 0.16
169 0.15
170 0.15
171 0.17
172 0.15
173 0.16
174 0.15
175 0.13
176 0.13
177 0.11
178 0.11
179 0.1
180 0.12
181 0.12
182 0.14
183 0.16
184 0.16
185 0.16
186 0.17
187 0.15
188 0.13
189 0.12
190 0.11
191 0.1
192 0.08
193 0.08
194 0.06
195 0.06
196 0.06
197 0.06
198 0.05
199 0.06
200 0.07
201 0.08
202 0.1
203 0.1
204 0.1
205 0.11
206 0.11
207 0.12
208 0.11
209 0.11
210 0.1
211 0.11
212 0.1
213 0.11
214 0.14
215 0.15
216 0.17
217 0.16
218 0.16
219 0.17
220 0.18
221 0.18
222 0.15
223 0.18
224 0.17
225 0.2
226 0.2
227 0.21
228 0.2
229 0.2
230 0.21
231 0.19
232 0.22
233 0.24
234 0.25
235 0.23
236 0.24
237 0.29
238 0.3
239 0.31
240 0.32
241 0.32
242 0.41
243 0.5
244 0.58
245 0.61
246 0.68
247 0.73
248 0.78
249 0.82
250 0.82
251 0.81
252 0.8
253 0.8
254 0.81
255 0.84
256 0.81
257 0.77
258 0.74
259 0.72
260 0.73
261 0.73
262 0.73
263 0.72
264 0.73
265 0.74
266 0.73
267 0.69
268 0.61
269 0.54