Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2WVH0

Protein Details
Accession A0A1Y2WVH0    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
326-350AQNHHGDKRTHNNNKNRQSQEEQRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023398  TIF_eIF4e-like  
IPR001040  TIF_eIF_4E  
IPR019770  TIF_eIF_4E_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01652  IF4E  
PROSITE View protein in PROSITE  
PS00813  IF4E  
Amino Acid Sequences MDRQESIWTRRNNVTNLSLSTPSQSDNSTTPRDFSSLARRNGATSSHGRSNPFGATTPGGTLTSPTSAGGANQFGLGSGAFASFGSAKTPKSQGNPFEQAMGAVGAKTPSSEKTPKEAMRSTTGSKPSMGSISETSAQQASMATTHPLRDTWVFWYRPPITKANGYIEYDKTLHAMMSVKTVEEFWLAYSHLKRPSALPTVSDYHLFKKGIRPIWEDDENKLGGKWVLRLKKGVADRYYEDLLMACVGDQFGDEADELCGVVLSMRNGEDVLSIWTRSTGQKVLKIRETMRRVLNCPPETRIEFKSHDASMQQRSAIDEMRREKAAQNHHGDKRTHNNNKNRQSQEEQRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.5
3 0.49
4 0.47
5 0.41
6 0.35
7 0.35
8 0.3
9 0.26
10 0.23
11 0.21
12 0.2
13 0.22
14 0.27
15 0.31
16 0.31
17 0.31
18 0.31
19 0.32
20 0.31
21 0.31
22 0.36
23 0.38
24 0.41
25 0.44
26 0.43
27 0.42
28 0.43
29 0.4
30 0.34
31 0.31
32 0.34
33 0.37
34 0.4
35 0.4
36 0.4
37 0.41
38 0.37
39 0.33
40 0.28
41 0.23
42 0.22
43 0.2
44 0.19
45 0.18
46 0.16
47 0.14
48 0.14
49 0.13
50 0.12
51 0.12
52 0.11
53 0.1
54 0.1
55 0.11
56 0.12
57 0.11
58 0.1
59 0.1
60 0.09
61 0.08
62 0.09
63 0.08
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.1
73 0.11
74 0.12
75 0.16
76 0.2
77 0.23
78 0.28
79 0.34
80 0.36
81 0.42
82 0.47
83 0.43
84 0.41
85 0.37
86 0.31
87 0.25
88 0.2
89 0.12
90 0.07
91 0.07
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.14
98 0.2
99 0.21
100 0.26
101 0.35
102 0.37
103 0.42
104 0.44
105 0.41
106 0.42
107 0.44
108 0.41
109 0.4
110 0.4
111 0.35
112 0.32
113 0.3
114 0.25
115 0.23
116 0.2
117 0.16
118 0.13
119 0.14
120 0.15
121 0.14
122 0.14
123 0.12
124 0.12
125 0.1
126 0.09
127 0.07
128 0.06
129 0.07
130 0.07
131 0.08
132 0.09
133 0.09
134 0.09
135 0.1
136 0.11
137 0.12
138 0.15
139 0.22
140 0.22
141 0.22
142 0.29
143 0.3
144 0.34
145 0.36
146 0.34
147 0.29
148 0.32
149 0.34
150 0.31
151 0.31
152 0.28
153 0.27
154 0.25
155 0.24
156 0.22
157 0.19
158 0.15
159 0.12
160 0.1
161 0.08
162 0.1
163 0.07
164 0.1
165 0.1
166 0.09
167 0.09
168 0.09
169 0.09
170 0.07
171 0.07
172 0.05
173 0.06
174 0.07
175 0.09
176 0.1
177 0.14
178 0.18
179 0.18
180 0.18
181 0.19
182 0.24
183 0.27
184 0.26
185 0.23
186 0.23
187 0.26
188 0.26
189 0.27
190 0.22
191 0.19
192 0.24
193 0.23
194 0.2
195 0.24
196 0.3
197 0.33
198 0.36
199 0.37
200 0.36
201 0.42
202 0.48
203 0.42
204 0.37
205 0.35
206 0.31
207 0.27
208 0.23
209 0.18
210 0.13
211 0.12
212 0.16
213 0.2
214 0.25
215 0.26
216 0.28
217 0.28
218 0.33
219 0.38
220 0.4
221 0.35
222 0.33
223 0.34
224 0.37
225 0.37
226 0.3
227 0.25
228 0.18
229 0.16
230 0.12
231 0.1
232 0.05
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.04
248 0.04
249 0.05
250 0.06
251 0.07
252 0.07
253 0.08
254 0.08
255 0.08
256 0.08
257 0.07
258 0.11
259 0.11
260 0.11
261 0.11
262 0.11
263 0.13
264 0.15
265 0.18
266 0.2
267 0.23
268 0.3
269 0.37
270 0.42
271 0.47
272 0.51
273 0.52
274 0.55
275 0.57
276 0.56
277 0.58
278 0.57
279 0.53
280 0.57
281 0.62
282 0.56
283 0.54
284 0.51
285 0.49
286 0.48
287 0.5
288 0.45
289 0.41
290 0.4
291 0.42
292 0.43
293 0.37
294 0.36
295 0.34
296 0.36
297 0.37
298 0.36
299 0.33
300 0.29
301 0.3
302 0.31
303 0.33
304 0.31
305 0.32
306 0.35
307 0.38
308 0.39
309 0.38
310 0.41
311 0.43
312 0.49
313 0.5
314 0.54
315 0.6
316 0.65
317 0.71
318 0.68
319 0.69
320 0.69
321 0.71
322 0.73
323 0.73
324 0.76
325 0.8
326 0.87
327 0.89
328 0.85
329 0.82
330 0.79