Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2X3R1

Protein Details
Accession A0A1Y2X3R1   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-31IPTSADPRSKRPTKKRALTPVSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSGEGPESIPTSADPRSKRPTKKRALTPVSAQAHVVESLFAKPDQEIRIPDPSSGAGARKRDLPPPPEIVTNVQGSSAGAGSGEFHVYKASRRREYERLRRMDEEVSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.42
4 0.5
5 0.6
6 0.67
7 0.73
8 0.77
9 0.84
10 0.86
11 0.87
12 0.85
13 0.8
14 0.74
15 0.73
16 0.66
17 0.56
18 0.47
19 0.36
20 0.3
21 0.25
22 0.2
23 0.11
24 0.08
25 0.08
26 0.09
27 0.08
28 0.07
29 0.07
30 0.11
31 0.12
32 0.14
33 0.15
34 0.17
35 0.22
36 0.23
37 0.22
38 0.2
39 0.18
40 0.17
41 0.15
42 0.15
43 0.13
44 0.14
45 0.15
46 0.2
47 0.21
48 0.26
49 0.3
50 0.31
51 0.31
52 0.35
53 0.36
54 0.32
55 0.32
56 0.29
57 0.27
58 0.25
59 0.21
60 0.16
61 0.14
62 0.13
63 0.12
64 0.09
65 0.06
66 0.04
67 0.04
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.1
74 0.1
75 0.17
76 0.25
77 0.33
78 0.4
79 0.46
80 0.53
81 0.61
82 0.72
83 0.76
84 0.78
85 0.77
86 0.75
87 0.73
88 0.69