Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NNG0

Protein Details
Accession A8NNG0    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-126SSSPPPPPPPKPKPKPKPRRKAPPKKKAAPKKKAAPKRKAAPKKNNNRRRKRDLEDLEDLBasic
NLS Segment(s)
PositionSequence
71-118PPPPPPKPKPKPKPRRKAPPKKKAAPKKKAAPKRKAAPKKNNNRRRKR
Subcellular Location(s) extr 15, E.R. 4, cyto 2, plas 2, nucl 1, mito 1, pero 1, golg 1, mito_nucl 1
Family & Domain DBs
KEGG cci:CC1G_06529  -  
Amino Acid Sequences MVHFRATLAVAALSVVSSVVAVPVGFDEYDARRELTDLELVERDPLFGAIASVAGNLLGGLMGGGGSSSPPPPPPPKPKPKPKPRRKAPPKKKAAPKKKAAPKRKAAPKKNNNRRRKRDLEDLEDLVTRAIYEFDLDELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.03
9 0.04
10 0.04
11 0.06
12 0.05
13 0.06
14 0.08
15 0.1
16 0.13
17 0.14
18 0.14
19 0.13
20 0.13
21 0.14
22 0.13
23 0.14
24 0.12
25 0.13
26 0.13
27 0.13
28 0.14
29 0.13
30 0.11
31 0.09
32 0.09
33 0.07
34 0.06
35 0.06
36 0.04
37 0.05
38 0.04
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.01
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.04
57 0.05
58 0.08
59 0.13
60 0.21
61 0.31
62 0.4
63 0.51
64 0.6
65 0.71
66 0.79
67 0.85
68 0.9
69 0.91
70 0.92
71 0.92
72 0.94
73 0.94
74 0.95
75 0.95
76 0.94
77 0.94
78 0.92
79 0.92
80 0.92
81 0.92
82 0.9
83 0.88
84 0.88
85 0.88
86 0.89
87 0.88
88 0.87
89 0.86
90 0.86
91 0.88
92 0.88
93 0.88
94 0.89
95 0.9
96 0.91
97 0.93
98 0.93
99 0.93
100 0.94
101 0.93
102 0.92
103 0.91
104 0.87
105 0.87
106 0.85
107 0.82
108 0.77
109 0.69
110 0.61
111 0.51
112 0.44
113 0.33
114 0.24
115 0.16
116 0.1
117 0.08
118 0.06
119 0.07
120 0.07