Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2XDP7

Protein Details
Accession A0A1Y2XDP7    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-83MCTKNGCRHGRCKKCTWEKIPSIPCPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MAGEQNLEDHGKHRVVPPKPPPRPPTPDPPYKQDPPLYATHLWKCCKCKNSYAPQEIMCTKNGCRHGRCKKCTWEKIPSIPCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.42
4 0.51
5 0.58
6 0.64
7 0.71
8 0.71
9 0.71
10 0.76
11 0.71
12 0.71
13 0.67
14 0.7
15 0.64
16 0.65
17 0.64
18 0.59
19 0.58
20 0.5
21 0.45
22 0.38
23 0.37
24 0.34
25 0.3
26 0.3
27 0.31
28 0.33
29 0.34
30 0.34
31 0.38
32 0.39
33 0.43
34 0.42
35 0.46
36 0.49
37 0.57
38 0.63
39 0.62
40 0.6
41 0.55
42 0.57
43 0.51
44 0.43
45 0.35
46 0.28
47 0.24
48 0.28
49 0.35
50 0.37
51 0.4
52 0.49
53 0.57
54 0.66
55 0.71
56 0.73
57 0.76
58 0.8
59 0.85
60 0.82
61 0.82
62 0.79
63 0.83