Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2WY14

Protein Details
Accession A0A1Y2WY14    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-44TAPAIKRTTKPRVKKSPTTGTKHydrophilic
NLS Segment(s)
PositionSequence
28-104KRTTKPRVKKSPTTGTKPGPKVKAAKPTGVTKKKSVAPKKDGVATKVKAAVKKVEEKVEKAEEKVKKTSAKPKTAAK
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPREGTRSATGNSKPRVFQTVDTAPAIKRTTKPRVKKSPTTGTKPGPKVKAAKPTGVTKKKSVAPKKDGVATKVKAAVKKVEEKVEKAEEKVKKTSAKPKTAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.47
4 0.42
5 0.38
6 0.37
7 0.36
8 0.35
9 0.34
10 0.33
11 0.28
12 0.3
13 0.3
14 0.25
15 0.25
16 0.3
17 0.4
18 0.48
19 0.57
20 0.63
21 0.72
22 0.77
23 0.81
24 0.82
25 0.82
26 0.8
27 0.78
28 0.74
29 0.69
30 0.69
31 0.66
32 0.64
33 0.56
34 0.52
35 0.51
36 0.49
37 0.52
38 0.46
39 0.43
40 0.4
41 0.46
42 0.52
43 0.54
44 0.52
45 0.44
46 0.47
47 0.49
48 0.56
49 0.57
50 0.56
51 0.54
52 0.57
53 0.57
54 0.59
55 0.56
56 0.5
57 0.49
58 0.41
59 0.37
60 0.38
61 0.38
62 0.34
63 0.34
64 0.37
65 0.34
66 0.42
67 0.43
68 0.46
69 0.46
70 0.46
71 0.5
72 0.52
73 0.49
74 0.43
75 0.47
76 0.44
77 0.46
78 0.49
79 0.49
80 0.48
81 0.54
82 0.61
83 0.63
84 0.66