Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2X947

Protein Details
Accession A0A1Y2X947    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
205-230TYTPKMEPAPKGKRRKTTHLDCSKVQHydrophilic
NLS Segment(s)
PositionSequence
215-219KGKRR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPSAKPKLAQLKTPVTATFPSELSALSAKTPLSAVPDFIKEEYPTSVKTPITPPTAYMDFLKAMSMPSPLIPGKRSGTSSPEDDSTQDSVPSTASSEQTDCSCKCGNRKSLTSIPSSPLPGQPMSAPPAGVTSFPSLYMPPSPAMSTIDSPLSSTARSPFSARSVRSPFDWEAALKSRYSQGCRAHKSSAKSVRHIREVVTRTVTYTPKMEPAPKGKRRKTTHLDCSKVQAAAAAAAAARTNTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.4
4 0.36
5 0.3
6 0.22
7 0.2
8 0.18
9 0.17
10 0.16
11 0.16
12 0.13
13 0.12
14 0.13
15 0.12
16 0.12
17 0.12
18 0.11
19 0.15
20 0.15
21 0.16
22 0.17
23 0.2
24 0.21
25 0.22
26 0.24
27 0.19
28 0.2
29 0.22
30 0.21
31 0.2
32 0.21
33 0.24
34 0.22
35 0.24
36 0.26
37 0.28
38 0.31
39 0.29
40 0.28
41 0.3
42 0.31
43 0.3
44 0.27
45 0.23
46 0.19
47 0.18
48 0.17
49 0.12
50 0.11
51 0.1
52 0.1
53 0.08
54 0.08
55 0.11
56 0.12
57 0.14
58 0.15
59 0.18
60 0.19
61 0.21
62 0.24
63 0.22
64 0.25
65 0.26
66 0.28
67 0.26
68 0.25
69 0.23
70 0.21
71 0.22
72 0.2
73 0.17
74 0.15
75 0.13
76 0.12
77 0.11
78 0.11
79 0.09
80 0.08
81 0.09
82 0.1
83 0.11
84 0.11
85 0.12
86 0.16
87 0.15
88 0.17
89 0.19
90 0.2
91 0.26
92 0.33
93 0.39
94 0.41
95 0.43
96 0.46
97 0.48
98 0.49
99 0.46
100 0.4
101 0.35
102 0.31
103 0.3
104 0.25
105 0.2
106 0.2
107 0.15
108 0.14
109 0.13
110 0.13
111 0.14
112 0.13
113 0.12
114 0.09
115 0.11
116 0.1
117 0.1
118 0.1
119 0.09
120 0.09
121 0.09
122 0.1
123 0.08
124 0.09
125 0.1
126 0.1
127 0.09
128 0.09
129 0.09
130 0.1
131 0.12
132 0.12
133 0.12
134 0.12
135 0.12
136 0.11
137 0.11
138 0.12
139 0.11
140 0.09
141 0.1
142 0.11
143 0.13
144 0.14
145 0.15
146 0.16
147 0.21
148 0.27
149 0.27
150 0.32
151 0.34
152 0.35
153 0.35
154 0.38
155 0.33
156 0.29
157 0.29
158 0.21
159 0.2
160 0.24
161 0.24
162 0.19
163 0.19
164 0.23
165 0.26
166 0.3
167 0.33
168 0.38
169 0.46
170 0.53
171 0.56
172 0.57
173 0.58
174 0.59
175 0.62
176 0.63
177 0.58
178 0.59
179 0.64
180 0.63
181 0.65
182 0.6
183 0.53
184 0.52
185 0.51
186 0.48
187 0.44
188 0.38
189 0.34
190 0.38
191 0.37
192 0.3
193 0.29
194 0.26
195 0.27
196 0.3
197 0.33
198 0.35
199 0.43
200 0.52
201 0.59
202 0.68
203 0.71
204 0.78
205 0.8
206 0.84
207 0.84
208 0.84
209 0.85
210 0.85
211 0.83
212 0.74
213 0.74
214 0.67
215 0.57
216 0.46
217 0.37
218 0.27
219 0.22
220 0.2
221 0.13
222 0.09
223 0.09
224 0.09