Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8PAM1

Protein Details
Accession A8PAM1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
138-171NFFSGKGKKKDDKKTKKSQKSEKKSEKKEDKEADBasic
NLS Segment(s)
PositionSequence
115-166EKKDEEEKPKKLNWFQKMGRAIKNFFSGKGKKKDDKKTKKSQKSEKKSEKKE
Subcellular Location(s) E.R. 8, extr 4, golg 4, mito 3, vacu 3, cyto 2, mito_nucl 2
Family & Domain DBs
KEGG cci:CC1G_10394  -  
Amino Acid Sequences MVQLSIRVLLAAAIAAPAFANIVSTADEFEARDVATQDELFGRAVVEVLDDLYGRDELADLFGRDVDLEELTARDIEELLERELEFAEVDARDFADDLEVREFVDEVEARKDKDEKKDEEEKPKKLNWFQKMGRAIKNFFSGKGKKKDDKKTKKSQKSEKKSEKKEDKEADEPTTRAFEDSPVERSLDFVDDMFEREIDGSDLLERDFFDEDLFERDFDAELVERDFLDEDLFERDFDGELYERDVDDLLERAFEDELFERSYEFDELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.06
10 0.07
11 0.08
12 0.09
13 0.09
14 0.1
15 0.1
16 0.1
17 0.11
18 0.09
19 0.1
20 0.1
21 0.11
22 0.12
23 0.12
24 0.12
25 0.12
26 0.13
27 0.12
28 0.11
29 0.1
30 0.08
31 0.08
32 0.07
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.08
46 0.1
47 0.08
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.08
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.06
61 0.05
62 0.05
63 0.06
64 0.08
65 0.09
66 0.09
67 0.1
68 0.1
69 0.1
70 0.11
71 0.1
72 0.07
73 0.06
74 0.07
75 0.06
76 0.07
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.07
84 0.08
85 0.09
86 0.09
87 0.09
88 0.09
89 0.09
90 0.06
91 0.08
92 0.08
93 0.08
94 0.13
95 0.14
96 0.15
97 0.16
98 0.22
99 0.24
100 0.32
101 0.38
102 0.37
103 0.43
104 0.52
105 0.56
106 0.62
107 0.65
108 0.61
109 0.58
110 0.58
111 0.57
112 0.54
113 0.57
114 0.5
115 0.52
116 0.48
117 0.51
118 0.55
119 0.54
120 0.53
121 0.47
122 0.44
123 0.37
124 0.41
125 0.35
126 0.28
127 0.31
128 0.32
129 0.37
130 0.45
131 0.49
132 0.5
133 0.59
134 0.69
135 0.73
136 0.78
137 0.79
138 0.81
139 0.86
140 0.89
141 0.9
142 0.9
143 0.9
144 0.89
145 0.91
146 0.9
147 0.9
148 0.89
149 0.9
150 0.89
151 0.84
152 0.83
153 0.79
154 0.73
155 0.68
156 0.62
157 0.56
158 0.48
159 0.42
160 0.34
161 0.29
162 0.24
163 0.19
164 0.16
165 0.12
166 0.14
167 0.15
168 0.17
169 0.16
170 0.17
171 0.16
172 0.17
173 0.16
174 0.14
175 0.12
176 0.09
177 0.1
178 0.09
179 0.11
180 0.11
181 0.1
182 0.08
183 0.09
184 0.09
185 0.08
186 0.08
187 0.06
188 0.07
189 0.08
190 0.07
191 0.08
192 0.07
193 0.08
194 0.09
195 0.09
196 0.08
197 0.08
198 0.09
199 0.12
200 0.13
201 0.11
202 0.11
203 0.11
204 0.11
205 0.11
206 0.11
207 0.08
208 0.09
209 0.1
210 0.1
211 0.09
212 0.1
213 0.1
214 0.09
215 0.09
216 0.08
217 0.08
218 0.11
219 0.12
220 0.11
221 0.11
222 0.11
223 0.11
224 0.11
225 0.13
226 0.1
227 0.1
228 0.14
229 0.14
230 0.13
231 0.13
232 0.13
233 0.11
234 0.11
235 0.13
236 0.1
237 0.1
238 0.1
239 0.11
240 0.11
241 0.1
242 0.12
243 0.12
244 0.14
245 0.15
246 0.15
247 0.14
248 0.15
249 0.18