Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8P9M6

Protein Details
Accession A8P9M6   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSSKRSKHRNQKSTNNERPNRHPSTHydrophilic
51-72PPKPSLARTRIRKNRRPSLDKVHydrophilic
NLS Segment(s)
PositionSequence
58-66RTRIRKNRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
KEGG cci:CC1G_12919  -  
Amino Acid Sequences MSSKRSKHRNQKSTNNERPNRHPSTAVPPSKTPSSNPPSRWRYVELPETPPPKPSLARTRIRKNRRPSLDKVDDPDTDSSTEYLPFPKRRKGTPVTDDGLSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.88
4 0.84
5 0.83
6 0.81
7 0.77
8 0.68
9 0.6
10 0.53
11 0.54
12 0.58
13 0.54
14 0.49
15 0.44
16 0.46
17 0.47
18 0.45
19 0.37
20 0.37
21 0.39
22 0.43
23 0.45
24 0.51
25 0.52
26 0.54
27 0.54
28 0.49
29 0.46
30 0.44
31 0.46
32 0.39
33 0.39
34 0.42
35 0.43
36 0.38
37 0.35
38 0.32
39 0.27
40 0.25
41 0.25
42 0.29
43 0.34
44 0.42
45 0.49
46 0.59
47 0.67
48 0.76
49 0.78
50 0.78
51 0.8
52 0.82
53 0.8
54 0.76
55 0.77
56 0.75
57 0.7
58 0.65
59 0.59
60 0.5
61 0.46
62 0.41
63 0.32
64 0.24
65 0.22
66 0.18
67 0.14
68 0.15
69 0.13
70 0.17
71 0.23
72 0.3
73 0.35
74 0.43
75 0.47
76 0.52
77 0.6
78 0.62
79 0.65
80 0.65
81 0.67
82 0.62