Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2WVS3

Protein Details
Accession A0A1Y2WVS3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-75VQKSRNKTRGKGRKGEKGKQRKESBasic
NLS Segment(s)
PositionSequence
33-75SDRPPSRETKTKSKKTGAGVQKSRNKTRGKGRKGEKGKQRKES
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MGSNIIGVYSSRELNSHTNGSVASDTQPVERRSDRPPSRETKTKSKKTGAGVQKSRNKTRGKGRKGEKGKQRKES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.23
4 0.21
5 0.2
6 0.19
7 0.21
8 0.18
9 0.15
10 0.12
11 0.11
12 0.11
13 0.14
14 0.2
15 0.19
16 0.23
17 0.24
18 0.26
19 0.28
20 0.39
21 0.4
22 0.39
23 0.44
24 0.45
25 0.49
26 0.54
27 0.55
28 0.56
29 0.62
30 0.66
31 0.68
32 0.67
33 0.66
34 0.63
35 0.68
36 0.65
37 0.65
38 0.64
39 0.66
40 0.69
41 0.72
42 0.73
43 0.71
44 0.68
45 0.65
46 0.69
47 0.7
48 0.71
49 0.73
50 0.75
51 0.78
52 0.82
53 0.84
54 0.84
55 0.84