Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2X677

Protein Details
Accession A0A1Y2X677    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
32-51QGLPTRQQQQQQQRRPPPGAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029001  ITPase-like_fam  
IPR003697  Maf-like  
Gene Ontology GO:0047429  F:nucleoside triphosphate diphosphatase activity  
Pfam View protein in Pfam  
PF02545  Maf  
CDD cd00555  Maf  
Amino Acid Sequences MDEKKQPPPPEPTPSDPPPDYETSALEHGQGQGLPTRQQQQQQQRRPPPGALLDLPILKYMRTHRVILASASPRRRALLSQLGLPNLEIRASTKPEDLPKKDLGAHAYVSATAQQKALDVYSALIDEAGEKQSEPLPPPAFKSGGSSSDPRADDVDLDAQRARKDPDLVIAADTVIVTRDGNVLEKPSSEAAHIRMLRHLRDTRAHKVLTAVCCVAPRSDAQHPGYAMASHVEETKVLFGREHDGLPDDVIEAYVRTREGADKAGGYAVQGLGGALLIEKVDGAVDNVIGLPVRKTLQLCEKVIFRQNEESDEEEEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.59
4 0.55
5 0.51
6 0.48
7 0.44
8 0.37
9 0.33
10 0.29
11 0.31
12 0.27
13 0.22
14 0.19
15 0.17
16 0.17
17 0.16
18 0.14
19 0.16
20 0.18
21 0.2
22 0.24
23 0.29
24 0.32
25 0.38
26 0.46
27 0.53
28 0.62
29 0.69
30 0.75
31 0.78
32 0.82
33 0.79
34 0.71
35 0.66
36 0.59
37 0.54
38 0.45
39 0.38
40 0.33
41 0.3
42 0.29
43 0.25
44 0.21
45 0.16
46 0.18
47 0.2
48 0.26
49 0.28
50 0.3
51 0.3
52 0.34
53 0.35
54 0.33
55 0.35
56 0.33
57 0.36
58 0.39
59 0.4
60 0.37
61 0.37
62 0.36
63 0.31
64 0.31
65 0.34
66 0.32
67 0.35
68 0.36
69 0.35
70 0.34
71 0.32
72 0.26
73 0.17
74 0.15
75 0.09
76 0.09
77 0.12
78 0.16
79 0.17
80 0.18
81 0.21
82 0.3
83 0.38
84 0.4
85 0.41
86 0.4
87 0.4
88 0.4
89 0.39
90 0.34
91 0.27
92 0.24
93 0.2
94 0.18
95 0.15
96 0.13
97 0.15
98 0.14
99 0.13
100 0.12
101 0.11
102 0.12
103 0.12
104 0.12
105 0.08
106 0.06
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.04
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.09
120 0.11
121 0.12
122 0.17
123 0.19
124 0.2
125 0.22
126 0.24
127 0.22
128 0.21
129 0.23
130 0.19
131 0.2
132 0.22
133 0.21
134 0.2
135 0.25
136 0.25
137 0.21
138 0.2
139 0.17
140 0.15
141 0.14
142 0.19
143 0.13
144 0.14
145 0.14
146 0.15
147 0.15
148 0.16
149 0.17
150 0.13
151 0.14
152 0.14
153 0.16
154 0.17
155 0.16
156 0.15
157 0.14
158 0.12
159 0.1
160 0.09
161 0.06
162 0.04
163 0.04
164 0.03
165 0.04
166 0.05
167 0.05
168 0.07
169 0.07
170 0.08
171 0.08
172 0.09
173 0.1
174 0.1
175 0.1
176 0.1
177 0.11
178 0.12
179 0.19
180 0.2
181 0.19
182 0.23
183 0.25
184 0.26
185 0.31
186 0.31
187 0.28
188 0.34
189 0.4
190 0.42
191 0.45
192 0.44
193 0.37
194 0.39
195 0.4
196 0.35
197 0.31
198 0.25
199 0.2
200 0.21
201 0.21
202 0.17
203 0.13
204 0.12
205 0.15
206 0.18
207 0.24
208 0.25
209 0.28
210 0.28
211 0.28
212 0.27
213 0.22
214 0.18
215 0.13
216 0.11
217 0.09
218 0.09
219 0.08
220 0.08
221 0.08
222 0.12
223 0.12
224 0.12
225 0.12
226 0.12
227 0.16
228 0.17
229 0.17
230 0.15
231 0.15
232 0.15
233 0.15
234 0.14
235 0.1
236 0.08
237 0.09
238 0.08
239 0.06
240 0.06
241 0.07
242 0.07
243 0.07
244 0.08
245 0.11
246 0.13
247 0.16
248 0.17
249 0.16
250 0.17
251 0.17
252 0.16
253 0.13
254 0.13
255 0.09
256 0.08
257 0.07
258 0.06
259 0.05
260 0.05
261 0.05
262 0.03
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.04
270 0.05
271 0.05
272 0.05
273 0.06
274 0.06
275 0.06
276 0.06
277 0.07
278 0.07
279 0.09
280 0.11
281 0.14
282 0.15
283 0.21
284 0.31
285 0.38
286 0.39
287 0.41
288 0.43
289 0.46
290 0.53
291 0.51
292 0.45
293 0.47
294 0.46
295 0.46
296 0.46
297 0.43
298 0.37
299 0.37
300 0.34