Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N0E3

Protein Details
Accession A8N0E3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-78HNCAARMRERLRPKRRPHVIDSPGREBasic
NLS Segment(s)
PositionSequence
60-70RERLRPKRRPH
Subcellular Location(s) nucl 11, cyto 8, mito 6
Family & Domain DBs
KEGG cci:CC1G_12074  -  
Amino Acid Sequences MSATELKLKVMTQAQVDEALTEAKKEAFFAGLTGALASFSGVLSGHSVQLPSHNCAARMRERLRPKRRPHVIDSPGRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.17
5 0.13
6 0.13
7 0.11
8 0.1
9 0.09
10 0.09
11 0.09
12 0.1
13 0.09
14 0.08
15 0.08
16 0.08
17 0.08
18 0.07
19 0.07
20 0.06
21 0.05
22 0.04
23 0.04
24 0.04
25 0.03
26 0.02
27 0.03
28 0.03
29 0.03
30 0.05
31 0.05
32 0.06
33 0.06
34 0.07
35 0.07
36 0.12
37 0.14
38 0.16
39 0.2
40 0.2
41 0.22
42 0.24
43 0.29
44 0.31
45 0.38
46 0.39
47 0.43
48 0.53
49 0.63
50 0.71
51 0.76
52 0.79
53 0.81
54 0.88
55 0.86
56 0.83
57 0.83
58 0.82
59 0.81