Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2X995

Protein Details
Accession A0A1Y2X995    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-63EGHPKWKDSGRHKSRYKRNRLSSFQTRHKNABasic
NLS Segment(s)
PositionSequence
36-50PKWKDSGRHKSRYKR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
Amino Acid Sequences MIIFCKEERILSQALKDHARFRRSQREHGYPSEGHPKWKDSGRHKSRYKRNRLSSFQTRHKNALSNSYIAGRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.32
4 0.36
5 0.4
6 0.43
7 0.44
8 0.47
9 0.54
10 0.55
11 0.62
12 0.62
13 0.64
14 0.65
15 0.63
16 0.6
17 0.5
18 0.48
19 0.49
20 0.41
21 0.36
22 0.33
23 0.32
24 0.29
25 0.35
26 0.39
27 0.37
28 0.48
29 0.53
30 0.62
31 0.68
32 0.75
33 0.8
34 0.83
35 0.85
36 0.84
37 0.86
38 0.86
39 0.84
40 0.84
41 0.84
42 0.82
43 0.81
44 0.8
45 0.74
46 0.7
47 0.66
48 0.64
49 0.55
50 0.56
51 0.49
52 0.41
53 0.39