Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2X921

Protein Details
Accession A0A1Y2X921    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-31NSSQHNQSRKAHRNGIKKPKTNRYPSLKHydrophilic
NLS Segment(s)
PositionSequence
12-39RKAHRNGIKKPKTNRYPSLKGTDPKFRR
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences ESKNSSQHNQSRKAHRNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMRALVRYSPYRTHINSIARNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.8
4 0.81
5 0.84
6 0.83
7 0.81
8 0.82
9 0.83
10 0.84
11 0.82
12 0.81
13 0.78
14 0.75
15 0.71
16 0.69
17 0.64
18 0.59
19 0.55
20 0.56
21 0.51
22 0.53
23 0.56
24 0.58
25 0.62
26 0.64
27 0.7
28 0.63
29 0.69
30 0.63
31 0.63
32 0.6
33 0.55
34 0.5
35 0.43
36 0.4
37 0.31
38 0.29
39 0.22
40 0.21
41 0.21
42 0.25
43 0.26
44 0.3
45 0.36
46 0.38
47 0.43
48 0.46
49 0.49