Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WVF5

Protein Details
Accession A0A1Y2WVF5   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-117SAYIVPSRRKGKNKNSPKQTDHPDGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 10.333, cyto_mito 9.166, nucl 8, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019240  DUF2196  
Pfam View protein in Pfam  
PF09962  DUF2196  
Amino Acid Sequences VPKTTEVVRGAVVNIVLKADQRTGRQVSGTVRDVLTRGDHHRGIKVRLTDGRIGRVQSMSTASSTSNNIISDGVVSGGASTSAAVPLEQTELSAYIVPSRRKGKNKNSPKQTDHPDGSAWVTCPVCGAFEGDETAVAHHVSEHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.11
5 0.12
6 0.16
7 0.19
8 0.2
9 0.27
10 0.29
11 0.3
12 0.3
13 0.31
14 0.31
15 0.33
16 0.33
17 0.29
18 0.26
19 0.25
20 0.24
21 0.22
22 0.2
23 0.18
24 0.2
25 0.23
26 0.26
27 0.27
28 0.33
29 0.35
30 0.36
31 0.37
32 0.35
33 0.34
34 0.34
35 0.36
36 0.36
37 0.34
38 0.34
39 0.31
40 0.3
41 0.27
42 0.23
43 0.2
44 0.15
45 0.16
46 0.12
47 0.1
48 0.1
49 0.09
50 0.1
51 0.11
52 0.11
53 0.1
54 0.1
55 0.1
56 0.09
57 0.08
58 0.07
59 0.06
60 0.06
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.07
81 0.07
82 0.1
83 0.16
84 0.17
85 0.23
86 0.29
87 0.37
88 0.45
89 0.55
90 0.62
91 0.67
92 0.77
93 0.82
94 0.85
95 0.87
96 0.85
97 0.84
98 0.81
99 0.78
100 0.7
101 0.62
102 0.52
103 0.45
104 0.4
105 0.33
106 0.26
107 0.22
108 0.19
109 0.16
110 0.17
111 0.15
112 0.13
113 0.12
114 0.13
115 0.09
116 0.1
117 0.12
118 0.11
119 0.12
120 0.11
121 0.12
122 0.11
123 0.1
124 0.09