Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WSV1

Protein Details
Accession A0A1Y2WSV1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
250-271SSGRGNSRSRSRDRSRRGMDVDHydrophilic
NLS Segment(s)
PositionSequence
144-151RKLRRKGR
252-263GRGNSRSRSRDR
Subcellular Location(s) cyto_nucl 14, nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005037  PRP38  
Gene Ontology GO:0071011  C:precatalytic spliceosome  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF03371  PRP38  
Amino Acid Sequences MGSDTHRADERRFLDERGSSAALAPNGLNPATIMEKAVRERIVESYFWKEQCFGVNEADIVDRVVDHVSFVGGTHGANQKPSPFLCLAFKLLQLAPDDAVLDEYLRYGGEKFKYLRALACFYVRLTRRAETVYKILEPFLEDRRKLRRKGRAGTSLTYVDQFVDDLLTKDRVCATSLWQMPKREILEDLELLEPRTSPLGDIEDLLEEEEDVDMNRDTNGDARADSEDEGLVEEGEQLSDRGRRRSTSGSSGRGNSRSRSRDRSRRGMDVDSNSQSDRDNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.38
4 0.35
5 0.33
6 0.27
7 0.26
8 0.28
9 0.22
10 0.21
11 0.19
12 0.15
13 0.16
14 0.16
15 0.13
16 0.1
17 0.12
18 0.13
19 0.13
20 0.13
21 0.13
22 0.17
23 0.19
24 0.24
25 0.22
26 0.21
27 0.22
28 0.26
29 0.26
30 0.24
31 0.25
32 0.28
33 0.32
34 0.32
35 0.31
36 0.27
37 0.25
38 0.3
39 0.3
40 0.25
41 0.22
42 0.22
43 0.21
44 0.21
45 0.2
46 0.14
47 0.11
48 0.08
49 0.06
50 0.06
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.05
60 0.06
61 0.1
62 0.15
63 0.15
64 0.17
65 0.17
66 0.18
67 0.21
68 0.21
69 0.21
70 0.17
71 0.18
72 0.2
73 0.21
74 0.23
75 0.21
76 0.21
77 0.2
78 0.19
79 0.19
80 0.18
81 0.17
82 0.13
83 0.12
84 0.12
85 0.09
86 0.09
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.04
93 0.05
94 0.05
95 0.09
96 0.1
97 0.14
98 0.16
99 0.19
100 0.22
101 0.22
102 0.25
103 0.24
104 0.25
105 0.22
106 0.23
107 0.2
108 0.17
109 0.23
110 0.21
111 0.22
112 0.21
113 0.21
114 0.21
115 0.23
116 0.24
117 0.2
118 0.22
119 0.21
120 0.19
121 0.18
122 0.17
123 0.14
124 0.14
125 0.13
126 0.17
127 0.2
128 0.19
129 0.23
130 0.33
131 0.4
132 0.45
133 0.51
134 0.54
135 0.58
136 0.65
137 0.7
138 0.69
139 0.66
140 0.61
141 0.56
142 0.48
143 0.4
144 0.32
145 0.25
146 0.15
147 0.12
148 0.1
149 0.06
150 0.05
151 0.05
152 0.06
153 0.07
154 0.09
155 0.09
156 0.1
157 0.11
158 0.11
159 0.12
160 0.12
161 0.14
162 0.2
163 0.24
164 0.3
165 0.34
166 0.34
167 0.34
168 0.39
169 0.36
170 0.29
171 0.27
172 0.23
173 0.21
174 0.2
175 0.21
176 0.17
177 0.16
178 0.16
179 0.14
180 0.12
181 0.09
182 0.1
183 0.08
184 0.07
185 0.08
186 0.1
187 0.1
188 0.11
189 0.11
190 0.1
191 0.1
192 0.1
193 0.09
194 0.06
195 0.06
196 0.05
197 0.05
198 0.04
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.07
205 0.09
206 0.11
207 0.1
208 0.1
209 0.11
210 0.13
211 0.14
212 0.14
213 0.13
214 0.11
215 0.1
216 0.11
217 0.1
218 0.08
219 0.07
220 0.07
221 0.06
222 0.06
223 0.06
224 0.06
225 0.08
226 0.14
227 0.17
228 0.23
229 0.26
230 0.29
231 0.34
232 0.41
233 0.45
234 0.5
235 0.54
236 0.54
237 0.56
238 0.59
239 0.6
240 0.59
241 0.57
242 0.53
243 0.55
244 0.57
245 0.6
246 0.65
247 0.69
248 0.73
249 0.79
250 0.83
251 0.8
252 0.81
253 0.78
254 0.75
255 0.72
256 0.69
257 0.67
258 0.61
259 0.56
260 0.48
261 0.44