Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2X3E8

Protein Details
Accession A0A1Y2X3E8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-35SGHNNSKIRKLKAKGKKFRCWGKGRREVGBasic
NLS Segment(s)
PositionSequence
13-42KIRKLKAKGKKFRCWGKGRREVGYSGGPKR
Subcellular Location(s) plas 11, mito 9.5, cyto_mito 6, E.R. 2, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCAYVSSGHNNSKIRKLKAKGKKFRCWGKGRREVGYSGGPKRKIIIIIITIIIIVTNITHETKSSIWQKSLHGREDWARLLHISYMNEMGPLDVLRFTTTEQTAGFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.62
4 0.67
5 0.73
6 0.8
7 0.8
8 0.82
9 0.85
10 0.85
11 0.87
12 0.87
13 0.86
14 0.84
15 0.84
16 0.85
17 0.79
18 0.73
19 0.65
20 0.57
21 0.5
22 0.48
23 0.43
24 0.4
25 0.41
26 0.38
27 0.36
28 0.36
29 0.34
30 0.27
31 0.23
32 0.19
33 0.14
34 0.14
35 0.14
36 0.12
37 0.1
38 0.09
39 0.08
40 0.05
41 0.03
42 0.02
43 0.03
44 0.04
45 0.04
46 0.05
47 0.05
48 0.07
49 0.08
50 0.14
51 0.2
52 0.21
53 0.23
54 0.25
55 0.29
56 0.37
57 0.41
58 0.39
59 0.33
60 0.33
61 0.35
62 0.38
63 0.37
64 0.28
65 0.24
66 0.21
67 0.21
68 0.21
69 0.2
70 0.16
71 0.15
72 0.16
73 0.15
74 0.15
75 0.14
76 0.12
77 0.09
78 0.09
79 0.08
80 0.07
81 0.08
82 0.08
83 0.09
84 0.11
85 0.15
86 0.16
87 0.17