Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WXF9

Protein Details
Accession A0A1Y2WXF9    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
278-327QMAALGKKPPRRWRREGIVRDPYWNRPRGPRTQPPRRPRTQFTRRPREFAHydrophilic
NLS Segment(s)
PositionSequence
135-139KKKTR
165-187KRLKRLKIIKEEPAPKKPPTVKK
283-324GKKPPRRWRREGIVRDPYWNRPRGPRTQPPRRPRTQFTRRPR
Subcellular Location(s) mito 14.5, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MNCSCRTISLKIFVQSLAELRLSNSARQIRPQYSRVTGFRSQFAFTRPYSATATLRFPQQISQESQEPTSHSPDTYQTSEIEQQEHSDHVAVEEPEVPVLDISADILDKAKSKGAILDLSPESIDALVTHSDKAKKKTRSARDKDVKADAAPESESDSAPSVETKRLKRLKIIKEEPAPKKPPTVKKEPWQIQKEALEQKFPEGWAPRKRLSPDALEGIRALHAQFPEEYTTEVLSAKFMVSPEAIRRILRSKWTPNAEEELDRQERWFKRGKNIWTQMAALGKKPPRRWRREGIVRDPYWNRPRGPRTQPPRRPRTQFTRRPREFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.27
4 0.22
5 0.18
6 0.15
7 0.15
8 0.23
9 0.23
10 0.24
11 0.3
12 0.35
13 0.36
14 0.43
15 0.5
16 0.5
17 0.55
18 0.57
19 0.56
20 0.54
21 0.59
22 0.55
23 0.54
24 0.53
25 0.49
26 0.5
27 0.46
28 0.41
29 0.37
30 0.37
31 0.34
32 0.28
33 0.31
34 0.27
35 0.28
36 0.29
37 0.3
38 0.3
39 0.29
40 0.34
41 0.29
42 0.32
43 0.3
44 0.28
45 0.28
46 0.3
47 0.32
48 0.31
49 0.34
50 0.35
51 0.35
52 0.36
53 0.33
54 0.32
55 0.3
56 0.3
57 0.27
58 0.22
59 0.22
60 0.24
61 0.28
62 0.27
63 0.25
64 0.21
65 0.23
66 0.29
67 0.28
68 0.26
69 0.21
70 0.21
71 0.2
72 0.2
73 0.17
74 0.13
75 0.11
76 0.1
77 0.13
78 0.11
79 0.11
80 0.12
81 0.11
82 0.1
83 0.1
84 0.1
85 0.06
86 0.06
87 0.05
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.07
96 0.08
97 0.1
98 0.1
99 0.1
100 0.12
101 0.14
102 0.15
103 0.13
104 0.17
105 0.16
106 0.16
107 0.15
108 0.13
109 0.11
110 0.09
111 0.09
112 0.04
113 0.05
114 0.07
115 0.07
116 0.08
117 0.11
118 0.17
119 0.22
120 0.28
121 0.36
122 0.4
123 0.49
124 0.58
125 0.65
126 0.71
127 0.74
128 0.78
129 0.79
130 0.77
131 0.72
132 0.67
133 0.57
134 0.46
135 0.41
136 0.3
137 0.21
138 0.17
139 0.13
140 0.11
141 0.11
142 0.11
143 0.09
144 0.1
145 0.09
146 0.09
147 0.09
148 0.08
149 0.13
150 0.18
151 0.19
152 0.28
153 0.33
154 0.34
155 0.41
156 0.49
157 0.52
158 0.58
159 0.61
160 0.58
161 0.6
162 0.69
163 0.67
164 0.65
165 0.61
166 0.52
167 0.54
168 0.55
169 0.57
170 0.54
171 0.59
172 0.57
173 0.61
174 0.71
175 0.71
176 0.73
177 0.68
178 0.64
179 0.59
180 0.55
181 0.53
182 0.51
183 0.44
184 0.37
185 0.32
186 0.32
187 0.29
188 0.26
189 0.23
190 0.2
191 0.27
192 0.32
193 0.37
194 0.38
195 0.42
196 0.44
197 0.45
198 0.44
199 0.4
200 0.36
201 0.37
202 0.34
203 0.3
204 0.27
205 0.23
206 0.2
207 0.16
208 0.13
209 0.09
210 0.09
211 0.1
212 0.1
213 0.11
214 0.12
215 0.12
216 0.13
217 0.11
218 0.11
219 0.11
220 0.11
221 0.1
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08
227 0.09
228 0.09
229 0.11
230 0.14
231 0.19
232 0.21
233 0.2
234 0.23
235 0.26
236 0.29
237 0.35
238 0.39
239 0.41
240 0.48
241 0.54
242 0.54
243 0.52
244 0.54
245 0.49
246 0.44
247 0.38
248 0.37
249 0.34
250 0.32
251 0.3
252 0.33
253 0.33
254 0.35
255 0.41
256 0.38
257 0.45
258 0.54
259 0.6
260 0.63
261 0.68
262 0.68
263 0.63
264 0.59
265 0.52
266 0.51
267 0.44
268 0.35
269 0.36
270 0.37
271 0.42
272 0.49
273 0.57
274 0.6
275 0.69
276 0.75
277 0.77
278 0.82
279 0.85
280 0.86
281 0.86
282 0.86
283 0.78
284 0.78
285 0.72
286 0.71
287 0.69
288 0.65
289 0.59
290 0.59
291 0.64
292 0.66
293 0.71
294 0.72
295 0.74
296 0.8
297 0.86
298 0.87
299 0.9
300 0.9
301 0.88
302 0.87
303 0.88
304 0.87
305 0.88
306 0.88
307 0.89