Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2X0U2

Protein Details
Accession A0A1Y2X0U2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-83SAFLRQQKSRRWHSTTTKTNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, extr 7, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038816  Stationary_phase_5  
Gene Ontology GO:0070628  F:proteasome binding  
Amino Acid Sequences MLAPLGGGGIWAPAALRVVRTAALKAGKMIRAKIAAATRPANTALEPVLVRSTPNPRQPIHPSAFLRQQKSRRWHSTTTKTNITYKNINAAIRRFMSTGRLDAAPRVDRSKFLNTQTGRAVAQITGRAPFASTLRPNLTGGALPRTAGGYGLGSGRVGGARYFSHAPAAQAQVVQNVSAAVRAFWISGQKAQFDGFTARGERKYRAVSTLEEEASRKMAAVKRDAPGSFIDFHLSPTVTALSPLAAAFPYPSAGFKFPALDATTLNTDGFLDVLSVDFARALKDLTSTLADIKKLSSLGDLPIQLEKGHTLRVRFPGVDAETVESLCDDFGLTRGVVREDLDFAAETGVSMALKFPFAPGVETNGTRTLTSPGGSLRSQGSFFPAEEDFSDMEDNPWLSLPDDLEGYESMSPPVSSGEHCSEDFEGLEGIYRFLEECDRAHGRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.12
6 0.14
7 0.16
8 0.17
9 0.2
10 0.24
11 0.23
12 0.27
13 0.31
14 0.34
15 0.36
16 0.37
17 0.36
18 0.35
19 0.35
20 0.36
21 0.36
22 0.35
23 0.37
24 0.39
25 0.35
26 0.34
27 0.35
28 0.31
29 0.25
30 0.23
31 0.18
32 0.18
33 0.17
34 0.16
35 0.17
36 0.16
37 0.17
38 0.19
39 0.27
40 0.32
41 0.4
42 0.44
43 0.43
44 0.51
45 0.57
46 0.62
47 0.57
48 0.58
49 0.54
50 0.54
51 0.63
52 0.62
53 0.61
54 0.6
55 0.64
56 0.65
57 0.7
58 0.74
59 0.74
60 0.74
61 0.77
62 0.79
63 0.81
64 0.82
65 0.79
66 0.77
67 0.71
68 0.72
69 0.68
70 0.63
71 0.59
72 0.5
73 0.51
74 0.47
75 0.47
76 0.43
77 0.4
78 0.41
79 0.36
80 0.37
81 0.29
82 0.26
83 0.28
84 0.26
85 0.25
86 0.22
87 0.22
88 0.21
89 0.22
90 0.27
91 0.26
92 0.26
93 0.28
94 0.27
95 0.27
96 0.31
97 0.38
98 0.37
99 0.37
100 0.43
101 0.4
102 0.43
103 0.43
104 0.4
105 0.32
106 0.27
107 0.25
108 0.17
109 0.18
110 0.16
111 0.15
112 0.14
113 0.14
114 0.13
115 0.12
116 0.13
117 0.12
118 0.16
119 0.17
120 0.2
121 0.22
122 0.24
123 0.24
124 0.23
125 0.23
126 0.18
127 0.18
128 0.17
129 0.15
130 0.13
131 0.13
132 0.13
133 0.12
134 0.1
135 0.09
136 0.06
137 0.06
138 0.07
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.06
147 0.06
148 0.1
149 0.12
150 0.12
151 0.14
152 0.15
153 0.16
154 0.17
155 0.18
156 0.16
157 0.15
158 0.15
159 0.15
160 0.14
161 0.13
162 0.1
163 0.08
164 0.08
165 0.08
166 0.07
167 0.05
168 0.05
169 0.06
170 0.06
171 0.06
172 0.09
173 0.09
174 0.13
175 0.14
176 0.13
177 0.14
178 0.14
179 0.14
180 0.12
181 0.13
182 0.1
183 0.11
184 0.12
185 0.14
186 0.17
187 0.2
188 0.2
189 0.22
190 0.24
191 0.24
192 0.25
193 0.25
194 0.23
195 0.23
196 0.25
197 0.22
198 0.19
199 0.19
200 0.16
201 0.15
202 0.13
203 0.1
204 0.11
205 0.13
206 0.15
207 0.19
208 0.22
209 0.23
210 0.26
211 0.26
212 0.23
213 0.21
214 0.21
215 0.17
216 0.14
217 0.14
218 0.11
219 0.12
220 0.12
221 0.11
222 0.09
223 0.08
224 0.09
225 0.07
226 0.07
227 0.07
228 0.05
229 0.06
230 0.05
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.05
237 0.05
238 0.06
239 0.07
240 0.08
241 0.09
242 0.1
243 0.11
244 0.1
245 0.13
246 0.13
247 0.12
248 0.11
249 0.12
250 0.13
251 0.12
252 0.12
253 0.09
254 0.08
255 0.07
256 0.07
257 0.05
258 0.04
259 0.03
260 0.03
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.05
267 0.05
268 0.06
269 0.06
270 0.07
271 0.07
272 0.08
273 0.09
274 0.09
275 0.12
276 0.13
277 0.14
278 0.13
279 0.13
280 0.13
281 0.13
282 0.12
283 0.1
284 0.1
285 0.11
286 0.13
287 0.13
288 0.13
289 0.14
290 0.14
291 0.13
292 0.12
293 0.13
294 0.11
295 0.16
296 0.17
297 0.18
298 0.22
299 0.27
300 0.3
301 0.28
302 0.27
303 0.28
304 0.28
305 0.27
306 0.23
307 0.2
308 0.18
309 0.18
310 0.17
311 0.1
312 0.09
313 0.07
314 0.06
315 0.04
316 0.04
317 0.05
318 0.07
319 0.06
320 0.08
321 0.09
322 0.1
323 0.11
324 0.11
325 0.12
326 0.12
327 0.12
328 0.12
329 0.11
330 0.1
331 0.1
332 0.08
333 0.07
334 0.06
335 0.06
336 0.05
337 0.05
338 0.06
339 0.06
340 0.07
341 0.07
342 0.07
343 0.09
344 0.1
345 0.13
346 0.12
347 0.18
348 0.2
349 0.21
350 0.23
351 0.24
352 0.24
353 0.22
354 0.22
355 0.2
356 0.18
357 0.18
358 0.17
359 0.16
360 0.19
361 0.19
362 0.2
363 0.19
364 0.2
365 0.21
366 0.19
367 0.22
368 0.19
369 0.19
370 0.21
371 0.18
372 0.18
373 0.17
374 0.2
375 0.16
376 0.15
377 0.17
378 0.14
379 0.14
380 0.15
381 0.15
382 0.12
383 0.13
384 0.12
385 0.11
386 0.12
387 0.12
388 0.11
389 0.11
390 0.11
391 0.12
392 0.11
393 0.13
394 0.13
395 0.12
396 0.12
397 0.12
398 0.12
399 0.11
400 0.12
401 0.12
402 0.12
403 0.18
404 0.22
405 0.25
406 0.25
407 0.27
408 0.27
409 0.26
410 0.25
411 0.2
412 0.15
413 0.11
414 0.15
415 0.13
416 0.12
417 0.11
418 0.11
419 0.11
420 0.12
421 0.16
422 0.14
423 0.15
424 0.22