Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2XCR1

Protein Details
Accession A0A1Y2XCR1    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
144-165IGTASKTKKKRSQDVRRSTRTAHydrophilic
NLS Segment(s)
PositionSequence
151-154KKKR
189-230ASLKLKSGGVIRRTRTRGTRAKPEAAKKEWQVEKILGTRKTK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPPSYSYSYDASSPTPFHKTPHRVLHPSSVDRYINGPAGQPRKPAQPPTVLHLGSIEEEAGVFNDDEYNDRQYLELSPCYNIQRRSMRTRAMARLNEETEADDEFVRGSRRIQETPSRSEIPSSVIPDTNTPVRKAAGKLAVVIGTASKTKKKRSQDVRRSTRTAAAVATSRIAETSAKKPKTLSSIPASLKLKSGGVIRRTRTRGTRAKPEAAKKEWQVEKILGTRKTKSRGKCSSLRNILEEFTYTSVVCHSLLYNLVAGNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.29
4 0.31
5 0.39
6 0.45
7 0.51
8 0.59
9 0.64
10 0.63
11 0.65
12 0.71
13 0.69
14 0.66
15 0.61
16 0.56
17 0.48
18 0.43
19 0.42
20 0.35
21 0.31
22 0.26
23 0.26
24 0.27
25 0.33
26 0.34
27 0.36
28 0.36
29 0.42
30 0.47
31 0.49
32 0.47
33 0.5
34 0.49
35 0.5
36 0.55
37 0.46
38 0.4
39 0.35
40 0.31
41 0.23
42 0.21
43 0.15
44 0.07
45 0.07
46 0.07
47 0.06
48 0.07
49 0.05
50 0.05
51 0.06
52 0.07
53 0.09
54 0.11
55 0.14
56 0.13
57 0.13
58 0.13
59 0.13
60 0.17
61 0.18
62 0.19
63 0.17
64 0.18
65 0.2
66 0.25
67 0.29
68 0.27
69 0.32
70 0.37
71 0.42
72 0.48
73 0.51
74 0.51
75 0.52
76 0.57
77 0.56
78 0.56
79 0.53
80 0.49
81 0.49
82 0.45
83 0.39
84 0.33
85 0.26
86 0.19
87 0.17
88 0.14
89 0.09
90 0.08
91 0.07
92 0.08
93 0.09
94 0.08
95 0.09
96 0.14
97 0.18
98 0.2
99 0.23
100 0.3
101 0.33
102 0.38
103 0.42
104 0.38
105 0.34
106 0.34
107 0.31
108 0.26
109 0.24
110 0.21
111 0.17
112 0.16
113 0.16
114 0.16
115 0.17
116 0.18
117 0.18
118 0.16
119 0.16
120 0.16
121 0.17
122 0.18
123 0.2
124 0.19
125 0.18
126 0.18
127 0.17
128 0.17
129 0.14
130 0.13
131 0.09
132 0.06
133 0.08
134 0.08
135 0.14
136 0.18
137 0.25
138 0.33
139 0.4
140 0.5
141 0.59
142 0.69
143 0.74
144 0.82
145 0.84
146 0.83
147 0.8
148 0.71
149 0.65
150 0.55
151 0.44
152 0.34
153 0.26
154 0.2
155 0.17
156 0.16
157 0.11
158 0.1
159 0.09
160 0.09
161 0.09
162 0.12
163 0.2
164 0.29
165 0.3
166 0.31
167 0.32
168 0.34
169 0.4
170 0.4
171 0.36
172 0.32
173 0.39
174 0.4
175 0.46
176 0.45
177 0.38
178 0.36
179 0.32
180 0.26
181 0.21
182 0.25
183 0.24
184 0.3
185 0.36
186 0.39
187 0.46
188 0.5
189 0.53
190 0.54
191 0.57
192 0.59
193 0.6
194 0.67
195 0.64
196 0.69
197 0.71
198 0.74
199 0.74
200 0.68
201 0.69
202 0.61
203 0.64
204 0.6
205 0.55
206 0.49
207 0.43
208 0.43
209 0.42
210 0.47
211 0.43
212 0.43
213 0.48
214 0.51
215 0.58
216 0.61
217 0.63
218 0.65
219 0.69
220 0.72
221 0.73
222 0.75
223 0.77
224 0.79
225 0.74
226 0.67
227 0.59
228 0.53
229 0.46
230 0.39
231 0.3
232 0.22
233 0.2
234 0.16
235 0.15
236 0.14
237 0.15
238 0.13
239 0.12
240 0.1
241 0.11
242 0.13
243 0.14
244 0.14