Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2WX59

Protein Details
Accession A0A1Y2WX59    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-69SEITWKEKNQRPRPKPRPSTTPKPKPNPEDNSHydrophilic
NLS Segment(s)
PositionSequence
45-62KNQRPRPKPRPSTTPKPK
Subcellular Location(s) nucl 18, cyto_nucl 12.333, cyto 4.5, cyto_pero 3.166
Family & Domain DBs
Amino Acid Sequences MLSNTKSSNIGKNQDGQGRTMDLEFDNRPLVDEGRSGSEITWKEKNQRPRPKPRPSTTPKPKPNPEDNSQNRAEPWKTDLSDLGYDLDRLKEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.41
4 0.36
5 0.32
6 0.3
7 0.24
8 0.19
9 0.14
10 0.17
11 0.16
12 0.15
13 0.15
14 0.14
15 0.15
16 0.15
17 0.15
18 0.12
19 0.12
20 0.12
21 0.13
22 0.14
23 0.13
24 0.12
25 0.16
26 0.17
27 0.2
28 0.24
29 0.22
30 0.29
31 0.34
32 0.45
33 0.5
34 0.59
35 0.65
36 0.71
37 0.8
38 0.83
39 0.88
40 0.83
41 0.83
42 0.81
43 0.83
44 0.83
45 0.83
46 0.82
47 0.82
48 0.84
49 0.81
50 0.82
51 0.78
52 0.73
53 0.73
54 0.7
55 0.67
56 0.61
57 0.54
58 0.46
59 0.45
60 0.41
61 0.32
62 0.3
63 0.31
64 0.3
65 0.3
66 0.3
67 0.29
68 0.29
69 0.28
70 0.25
71 0.19
72 0.19
73 0.19