Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WUX6

Protein Details
Accession A0A1Y2WUX6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
235-254ETKRQNSKTAAKEARRRKEAHydrophilic
NLS Segment(s)
PositionSequence
246-251KEARRR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.166, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037475  Sos7  
Gene Ontology GO:0000776  C:kinetochore  
GO:0034501  P:protein localization to kinetochore  
Amino Acid Sequences MASPSAEDVLTKLRALGAEQDITILKLSEPISAAVTHLQDAHQRTSDVSNSSLDATTPSSLEADLTHYRELFAKLRFSYVEQVSKEKFIRAIVGDPPLIVSPQENLDLEKENLEAKATLKALKTEVAAMVAELEEKARNLSRKYEKIKVETVKLEELPRKIEELENAVADLKKTQKRGSNPNPELNLPLAKTLDLVESKKRRKAELDRQLEQLQSQVPRKKKELDRLQAELQPLETKRQNSKTAAKEARRRKEAALGGVQDDLEERGRWFRSAEAGLKQVLEIES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.21
4 0.2
5 0.19
6 0.19
7 0.2
8 0.19
9 0.2
10 0.19
11 0.13
12 0.09
13 0.12
14 0.13
15 0.13
16 0.14
17 0.14
18 0.15
19 0.15
20 0.16
21 0.15
22 0.15
23 0.14
24 0.13
25 0.14
26 0.18
27 0.21
28 0.24
29 0.23
30 0.22
31 0.23
32 0.26
33 0.29
34 0.25
35 0.23
36 0.21
37 0.2
38 0.21
39 0.19
40 0.15
41 0.13
42 0.13
43 0.12
44 0.11
45 0.11
46 0.1
47 0.1
48 0.1
49 0.09
50 0.12
51 0.15
52 0.17
53 0.18
54 0.17
55 0.18
56 0.2
57 0.23
58 0.22
59 0.21
60 0.24
61 0.23
62 0.25
63 0.26
64 0.26
65 0.29
66 0.28
67 0.32
68 0.28
69 0.32
70 0.32
71 0.35
72 0.34
73 0.29
74 0.26
75 0.2
76 0.22
77 0.18
78 0.2
79 0.17
80 0.19
81 0.18
82 0.16
83 0.16
84 0.14
85 0.12
86 0.1
87 0.08
88 0.06
89 0.08
90 0.09
91 0.09
92 0.09
93 0.11
94 0.13
95 0.13
96 0.13
97 0.12
98 0.11
99 0.11
100 0.11
101 0.1
102 0.08
103 0.11
104 0.11
105 0.14
106 0.13
107 0.14
108 0.15
109 0.15
110 0.15
111 0.12
112 0.11
113 0.09
114 0.09
115 0.07
116 0.07
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.08
125 0.11
126 0.12
127 0.2
128 0.26
129 0.34
130 0.39
131 0.46
132 0.47
133 0.48
134 0.54
135 0.48
136 0.45
137 0.4
138 0.37
139 0.31
140 0.29
141 0.29
142 0.26
143 0.24
144 0.23
145 0.21
146 0.2
147 0.18
148 0.18
149 0.16
150 0.16
151 0.16
152 0.13
153 0.13
154 0.13
155 0.12
156 0.11
157 0.12
158 0.15
159 0.18
160 0.2
161 0.24
162 0.3
163 0.36
164 0.47
165 0.55
166 0.6
167 0.61
168 0.65
169 0.63
170 0.58
171 0.53
172 0.44
173 0.36
174 0.25
175 0.21
176 0.15
177 0.13
178 0.12
179 0.11
180 0.12
181 0.13
182 0.14
183 0.22
184 0.31
185 0.37
186 0.42
187 0.43
188 0.43
189 0.5
190 0.58
191 0.6
192 0.62
193 0.65
194 0.63
195 0.65
196 0.64
197 0.56
198 0.45
199 0.36
200 0.29
201 0.26
202 0.31
203 0.33
204 0.38
205 0.43
206 0.47
207 0.55
208 0.59
209 0.64
210 0.67
211 0.7
212 0.7
213 0.7
214 0.7
215 0.64
216 0.58
217 0.47
218 0.38
219 0.33
220 0.28
221 0.29
222 0.29
223 0.31
224 0.38
225 0.44
226 0.49
227 0.5
228 0.58
229 0.58
230 0.64
231 0.69
232 0.69
233 0.72
234 0.77
235 0.81
236 0.78
237 0.74
238 0.66
239 0.65
240 0.62
241 0.59
242 0.55
243 0.47
244 0.42
245 0.4
246 0.37
247 0.27
248 0.23
249 0.18
250 0.13
251 0.12
252 0.12
253 0.17
254 0.19
255 0.2
256 0.21
257 0.21
258 0.25
259 0.3
260 0.34
261 0.32
262 0.33
263 0.34
264 0.33
265 0.3