Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WTP3

Protein Details
Accession A0A1Y2WTP3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
31-53YVERGRERKRTRFRMDRLRPCIWBasic
NLS Segment(s)
PositionSequence
36-44RERKRTRFR
Subcellular Location(s) mito 9, E.R. 6, golg 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGASRLNPSKQAVTRRWTFFPILFLLRLVMYVERGRERKRTRFRMDRLRPCIWRREVKKRGEEYCIESELGSSSMNTTFCRDDYYLVTIAIFYGVLCYLVYHNSVWRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.57
4 0.53
5 0.5
6 0.42
7 0.39
8 0.36
9 0.3
10 0.25
11 0.22
12 0.19
13 0.16
14 0.15
15 0.13
16 0.09
17 0.09
18 0.1
19 0.13
20 0.17
21 0.22
22 0.25
23 0.33
24 0.4
25 0.48
26 0.58
27 0.65
28 0.69
29 0.75
30 0.8
31 0.82
32 0.85
33 0.85
34 0.82
35 0.77
36 0.74
37 0.67
38 0.67
39 0.61
40 0.59
41 0.56
42 0.59
43 0.62
44 0.63
45 0.69
46 0.67
47 0.64
48 0.6
49 0.56
50 0.5
51 0.45
52 0.39
53 0.31
54 0.24
55 0.21
56 0.18
57 0.16
58 0.1
59 0.07
60 0.07
61 0.08
62 0.09
63 0.1
64 0.12
65 0.13
66 0.13
67 0.17
68 0.17
69 0.17
70 0.19
71 0.22
72 0.2
73 0.19
74 0.19
75 0.14
76 0.14
77 0.12
78 0.09
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.07
86 0.09
87 0.11
88 0.1