Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2X129

Protein Details
Accession A0A1Y2X129    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-41HGNGHPRRSQPRQSHFRHLNPFEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR023271  Aquaporin-like  
IPR034294  Aquaporin_transptr  
IPR000425  MIP  
Gene Ontology GO:0016020  C:membrane  
GO:0015267  F:channel activity  
Pfam View protein in Pfam  
PF00230  MIP  
Amino Acid Sequences MPPHHEKRRRSVDDYGNGHGNGHPRRSQPRQSHFRHLNPFEQHLVAATGEFVGTFFFLFFGYAGHLMVLDQGAATSGASKVIYISLAYGFSLLVTVWAFYRISGGLFNPAVTLGLCLGGQLPWVRAAFLIPTQLIACMCAGAIVKVMFPGDIAAVNTTLAPGVNLAQGVFAEMFFTSYLVFVILMLAAEKSKDTYLAPLGIGLALFVAEIPGVFYTGGSLNPARSFGCAVAAPSFPGYHWIYWVGPLLGALIAAGYYRFVKICHYEEANPGQDNATAPPDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.69
3 0.62
4 0.55
5 0.5
6 0.42
7 0.41
8 0.36
9 0.37
10 0.38
11 0.39
12 0.49
13 0.56
14 0.64
15 0.66
16 0.72
17 0.76
18 0.78
19 0.83
20 0.83
21 0.83
22 0.83
23 0.77
24 0.74
25 0.69
26 0.66
27 0.58
28 0.49
29 0.4
30 0.31
31 0.27
32 0.19
33 0.14
34 0.1
35 0.07
36 0.06
37 0.06
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.04
57 0.04
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.06
67 0.05
68 0.06
69 0.06
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.06
85 0.06
86 0.06
87 0.07
88 0.06
89 0.07
90 0.07
91 0.07
92 0.1
93 0.1
94 0.1
95 0.09
96 0.08
97 0.08
98 0.07
99 0.07
100 0.04
101 0.05
102 0.04
103 0.04
104 0.05
105 0.04
106 0.05
107 0.06
108 0.06
109 0.07
110 0.08
111 0.08
112 0.07
113 0.08
114 0.08
115 0.08
116 0.08
117 0.06
118 0.07
119 0.07
120 0.07
121 0.07
122 0.06
123 0.06
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.05
144 0.04
145 0.04
146 0.04
147 0.03
148 0.03
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.05
156 0.05
157 0.04
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.04
164 0.04
165 0.05
166 0.04
167 0.04
168 0.03
169 0.04
170 0.03
171 0.03
172 0.03
173 0.04
174 0.03
175 0.04
176 0.04
177 0.05
178 0.05
179 0.06
180 0.07
181 0.09
182 0.11
183 0.12
184 0.12
185 0.11
186 0.11
187 0.1
188 0.09
189 0.06
190 0.04
191 0.03
192 0.03
193 0.03
194 0.02
195 0.02
196 0.02
197 0.03
198 0.03
199 0.04
200 0.04
201 0.04
202 0.06
203 0.06
204 0.07
205 0.09
206 0.09
207 0.11
208 0.11
209 0.13
210 0.12
211 0.12
212 0.14
213 0.11
214 0.13
215 0.12
216 0.13
217 0.15
218 0.14
219 0.14
220 0.14
221 0.14
222 0.11
223 0.16
224 0.17
225 0.15
226 0.16
227 0.18
228 0.17
229 0.18
230 0.21
231 0.16
232 0.13
233 0.13
234 0.12
235 0.09
236 0.09
237 0.07
238 0.04
239 0.04
240 0.04
241 0.04
242 0.05
243 0.06
244 0.07
245 0.08
246 0.08
247 0.13
248 0.19
249 0.23
250 0.28
251 0.32
252 0.34
253 0.4
254 0.46
255 0.46
256 0.41
257 0.38
258 0.33
259 0.3
260 0.28
261 0.25