Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8P5R1

Protein Details
Accession A8P5R1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTKKRRSGGRNKKGRGHVKFVBasic
86-111VRSREGRRNRAPPPRIRWKDGKKVNPBasic
NLS Segment(s)
PositionSequence
3-17KKRRSGGRNKKGRGH
87-110RSREGRRNRAPPPRIRWKDGKKVN
Subcellular Location(s) mito 15.5, mito_nucl 10.333, cyto 7.5, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cci:CC1G_11326  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTKKRRSGGRNKKGRGHVKFVRCSNCSRCVPKDKAIKRFTVRNMVESAAVRDLSEASVYSEYVIPKLYIKIAYCVSCAIHSHVVRVRSREGRRNRAPPPRIRWKDGKKVNPAVAAAEEAKNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.82
3 0.8
4 0.78
5 0.77
6 0.78
7 0.76
8 0.73
9 0.65
10 0.65
11 0.62
12 0.61
13 0.59
14 0.57
15 0.57
16 0.58
17 0.62
18 0.63
19 0.68
20 0.67
21 0.7
22 0.67
23 0.68
24 0.63
25 0.65
26 0.61
27 0.61
28 0.54
29 0.46
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.12
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.08
54 0.09
55 0.09
56 0.1
57 0.12
58 0.14
59 0.14
60 0.14
61 0.14
62 0.13
63 0.12
64 0.13
65 0.14
66 0.18
67 0.18
68 0.21
69 0.23
70 0.28
71 0.29
72 0.31
73 0.34
74 0.37
75 0.43
76 0.49
77 0.55
78 0.6
79 0.67
80 0.73
81 0.75
82 0.77
83 0.79
84 0.8
85 0.79
86 0.81
87 0.78
88 0.77
89 0.78
90 0.77
91 0.8
92 0.8
93 0.8
94 0.78
95 0.8
96 0.78
97 0.71
98 0.62
99 0.54
100 0.45
101 0.39
102 0.32
103 0.27