Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2XB15

Protein Details
Accession A0A1Y2XB15    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-35NANKLWSNRIEKKHDRRERERERERERERERBasic
NLS Segment(s)
PositionSequence
14-55IEKKHDRREREREREREREREREREREREREREERARDRVQR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDNANANKLWSNRIEKKHDRREREREREREREREREREREREREREERARDRVQRRMNRLTSFHLSLHLYVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.72
4 0.79
5 0.82
6 0.82
7 0.83
8 0.86
9 0.88
10 0.88
11 0.88
12 0.86
13 0.86
14 0.87
15 0.83
16 0.82
17 0.77
18 0.77
19 0.72
20 0.73
21 0.71
22 0.71
23 0.71
24 0.71
25 0.71
26 0.71
27 0.71
28 0.69
29 0.7
30 0.67
31 0.68
32 0.66
33 0.68
34 0.65
35 0.66
36 0.66
37 0.69
38 0.67
39 0.69
40 0.7
41 0.72
42 0.71
43 0.75
44 0.73
45 0.69
46 0.67
47 0.65
48 0.61
49 0.56
50 0.48
51 0.42
52 0.38