Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2X8I1

Protein Details
Accession A0A1Y2X8I1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
38-58QWSWATAKERKPRTKYRVSRMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MHVRSIIAILPIVPERTGSTAPKIVRWELVSILSEKLQWSWATAKERKPRTKYRVSRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.14
4 0.16
5 0.16
6 0.18
7 0.22
8 0.23
9 0.25
10 0.26
11 0.24
12 0.24
13 0.23
14 0.21
15 0.16
16 0.17
17 0.14
18 0.13
19 0.13
20 0.11
21 0.1
22 0.09
23 0.09
24 0.1
25 0.09
26 0.11
27 0.13
28 0.19
29 0.27
30 0.32
31 0.4
32 0.48
33 0.58
34 0.66
35 0.71
36 0.76
37 0.77
38 0.83