Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WKK2

Protein Details
Accession A0A1Y2WKK2   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-36AHAQAKRTPTPKRHGRPSKKPRKLCPYLKHPYKPABasic
NLS Segment(s)
PositionSequence
7-24KRTPTPKRHGRPSKKPRK
Subcellular Location(s) mito 12.5, cyto_mito 9.5, nucl 9, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAHAQAKRTPTPKRHGRPSKKPRKLCPYLKHPYKPAHIEPGMMRYCADPQCCTACPAALECIRVSQTHLRGSAWLCTLIYIPLWLVQDPKKLKAHPVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.87
4 0.89
5 0.92
6 0.93
7 0.93
8 0.92
9 0.91
10 0.91
11 0.9
12 0.89
13 0.87
14 0.85
15 0.86
16 0.86
17 0.81
18 0.77
19 0.73
20 0.69
21 0.66
22 0.58
23 0.56
24 0.47
25 0.43
26 0.38
27 0.38
28 0.33
29 0.26
30 0.24
31 0.16
32 0.19
33 0.2
34 0.2
35 0.14
36 0.15
37 0.18
38 0.18
39 0.19
40 0.16
41 0.13
42 0.13
43 0.13
44 0.15
45 0.13
46 0.14
47 0.12
48 0.13
49 0.14
50 0.14
51 0.16
52 0.18
53 0.21
54 0.24
55 0.25
56 0.23
57 0.25
58 0.26
59 0.26
60 0.21
61 0.19
62 0.15
63 0.15
64 0.15
65 0.13
66 0.12
67 0.08
68 0.08
69 0.1
70 0.11
71 0.11
72 0.15
73 0.18
74 0.26
75 0.3
76 0.36
77 0.39
78 0.4