FuNGI

A0A1Y2WM52

Protein Details

Accession

A0A1Y2WM52

Localization Confidence

Medium

Confidence Score

11.2

NoLS Segment(s)

Position	Sequence	Protein Nature
404-428	DDPHVSPRSRGTPRRRTNGSAPRPS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 24, cyto_nucl 14.5

Family & Domain DBs

InterPro	View protein in InterPro IPR039198 Srl3/Whi5 IPR013734 TF_Nrm1/Whi5
Gene Ontology	GO:0005737 C:cytoplasm GO:0005634 C:nucleus GO:0071930 P:negative regulation of transcription involved in G1/S transition of mitotic cell cycle
Pfam	View protein in Pfam PF08528 Whi5

Amino Acid Sequences

NSQSQPLNYSSNDSQDTTASNDTDRVFTPPESDSEASNGIGKGHDSSQESQLLQLSQLAAAQQRMSEVDGTAAAGGQSKKRMADGVVKHTRNSSSVSPVRPGHSRNTSTVSMASTSSRIGELSAELKTKLSYAMVKVNNGWQGHSIDEVESLASQVASPTSSTSTLHGRYGASASPRVAVAPMRHRASSMVTSPTSQHPTQGRPYDPSWREGNMKSPPSTSPITQVPSLAPPAPIQPRQPNQVHPRRSSNARFTPAYLSHPHHVSPHTPAQPSPLQATPGHGNIRTPNVDPILFSPHQNVREQEALETLMFMSSPGNSANVKHAFPSSLPSSQGSQTAQPLHPPQTRNGGRTALPTSRLGSGAEAGSQGRKSLPTARPQHHHALQVKRVGFEKSPGGYGGMDIDDPHVSPRSRGTPRRRTNGSAPRPSLSIPAGLSGPSRPRTALRGDDIERMLDRVAADDSSDSEGEIHIPQNRRVNG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.31
2	0.28
3	0.29
4	0.26
5	0.27
6	0.22
7	0.2
8	0.23
9	0.23
10	0.24
11	0.23
12	0.23
13	0.23
14	0.22
15	0.24
16	0.22
17	0.23
18	0.27
19	0.27
20	0.24
21	0.24
22	0.25
23	0.22
24	0.24
25	0.22
26	0.16
27	0.16
28	0.15
29	0.15
30	0.15
31	0.19
32	0.21
33	0.23
34	0.27
35	0.31
36	0.3
37	0.29
38	0.3
39	0.26
40	0.22
41	0.2
42	0.16
43	0.12
44	0.13
45	0.13
46	0.12
47	0.13
48	0.13
49	0.11
50	0.12
51	0.12
52	0.13
53	0.13
54	0.11
55	0.1
56	0.1
57	0.1
58	0.09
59	0.08
60	0.07
61	0.1
62	0.11
63	0.13
64	0.17
65	0.19
66	0.19
67	0.2
68	0.22
69	0.21
70	0.29
71	0.32
72	0.39
73	0.47
74	0.48
75	0.48
76	0.49
77	0.48
78	0.4
79	0.38
80	0.31
81	0.3
82	0.35
83	0.37
84	0.39
85	0.4
86	0.42
87	0.42
88	0.42
89	0.41
90	0.44
91	0.45
92	0.43
93	0.46
94	0.43
95	0.4
96	0.38
97	0.31
98	0.23
99	0.21
100	0.19
101	0.14
102	0.13
103	0.12
104	0.11
105	0.1
106	0.09
107	0.08
108	0.09
109	0.1
110	0.12
111	0.12
112	0.12
113	0.13
114	0.13
115	0.12
116	0.11
117	0.11
118	0.12
119	0.13
120	0.22
121	0.23
122	0.24
123	0.25
124	0.28
125	0.31
126	0.29
127	0.27
128	0.21
129	0.2
130	0.2
131	0.2
132	0.16
133	0.11
134	0.11
135	0.1
136	0.08
137	0.07
138	0.07
139	0.05
140	0.05
141	0.04
142	0.04
143	0.05
144	0.05
145	0.05
146	0.06
147	0.07
148	0.08
149	0.09
150	0.11
151	0.15
152	0.17
153	0.17
154	0.18
155	0.16
156	0.16
157	0.17
158	0.17
159	0.15
160	0.15
161	0.14
162	0.14
163	0.14
164	0.13
165	0.12
166	0.12
167	0.14
168	0.2
169	0.26
170	0.27
171	0.27
172	0.27
173	0.27
174	0.28
175	0.27
176	0.22
177	0.2
178	0.19
179	0.2
180	0.21
181	0.24
182	0.26
183	0.23
184	0.25
185	0.24
186	0.28
187	0.34
188	0.37
189	0.35
190	0.33
191	0.35
192	0.4
193	0.39
194	0.38
195	0.34
196	0.31
197	0.33
198	0.3
199	0.35
200	0.31
201	0.33
202	0.3
203	0.3
204	0.28
205	0.28
206	0.29
207	0.23
208	0.21
209	0.2
210	0.22
211	0.2
212	0.2
213	0.17
214	0.16
215	0.17
216	0.14
217	0.12
218	0.1
219	0.14
220	0.17
221	0.19
222	0.21
223	0.27
224	0.29
225	0.35
226	0.37
227	0.4
228	0.46
229	0.53
230	0.55
231	0.52
232	0.55
233	0.53
234	0.58
235	0.55
236	0.54
237	0.51
238	0.49
239	0.46
240	0.41
241	0.42
242	0.37
243	0.35
244	0.3
245	0.27
246	0.25
247	0.26
248	0.25
249	0.22
250	0.22
251	0.2
252	0.22
253	0.26
254	0.27
255	0.27
256	0.27
257	0.29
258	0.3
259	0.3
260	0.27
261	0.21
262	0.2
263	0.19
264	0.22
265	0.19
266	0.21
267	0.21
268	0.19
269	0.19
270	0.18
271	0.22
272	0.21
273	0.19
274	0.19
275	0.18
276	0.18
277	0.17
278	0.17
279	0.2
280	0.19
281	0.18
282	0.2
283	0.23
284	0.26
285	0.28
286	0.27
287	0.24
288	0.27
289	0.27
290	0.22
291	0.19
292	0.18
293	0.15
294	0.14
295	0.1
296	0.07
297	0.06
298	0.06
299	0.05
300	0.04
301	0.05
302	0.05
303	0.07
304	0.07
305	0.09
306	0.15
307	0.18
308	0.18
309	0.18
310	0.19
311	0.18
312	0.18
313	0.22
314	0.19
315	0.18
316	0.19
317	0.2
318	0.21
319	0.21
320	0.24
321	0.2
322	0.19
323	0.2
324	0.24
325	0.23
326	0.25
327	0.27
328	0.32
329	0.36
330	0.36
331	0.35
332	0.41
333	0.44
334	0.42
335	0.41
336	0.37
337	0.33
338	0.35
339	0.37
340	0.29
341	0.28
342	0.28
343	0.26
344	0.25
345	0.24
346	0.21
347	0.17
348	0.15
349	0.13
350	0.12
351	0.11
352	0.1
353	0.12
354	0.12
355	0.11
356	0.11
357	0.12
358	0.14
359	0.22
360	0.27
361	0.34
362	0.43
363	0.49
364	0.53
365	0.58
366	0.65
367	0.59
368	0.62
369	0.6
370	0.6
371	0.59
372	0.61
373	0.57
374	0.5
375	0.47
376	0.43
377	0.36
378	0.31
379	0.32
380	0.26
381	0.26
382	0.24
383	0.24
384	0.2
385	0.19
386	0.17
387	0.12
388	0.1
389	0.09
390	0.11
391	0.1
392	0.1
393	0.12
394	0.15
395	0.15
396	0.16
397	0.22
398	0.29
399	0.38
400	0.48
401	0.56
402	0.62
403	0.72
404	0.8
405	0.81
406	0.78
407	0.8
408	0.81
409	0.81
410	0.8
411	0.74
412	0.66
413	0.62
414	0.56
415	0.49
416	0.4
417	0.33
418	0.23
419	0.21
420	0.19
421	0.18
422	0.18
423	0.19
424	0.24
425	0.24
426	0.25
427	0.25
428	0.28
429	0.32
430	0.37
431	0.4
432	0.39
433	0.43
434	0.45
435	0.49
436	0.47
437	0.46
438	0.39
439	0.34
440	0.28
441	0.22
442	0.19
443	0.14
444	0.15
445	0.12
446	0.12
447	0.12
448	0.13
449	0.15
450	0.15
451	0.13
452	0.12
453	0.12
454	0.13
455	0.15
456	0.17
457	0.2
458	0.25
459	0.31

A0A1Y2WM52

3D AlphaFold-predicted Structure Viewer