Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2X7A8

Protein Details
Accession A0A1Y2X7A8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-86GVVYVKRRTKRKDRIMHAKGKNHIBasic
NLS Segment(s)
PositionSequence
68-93KRRTKRKDRIMHAKGKNHIPRRTGRR
Subcellular Location(s) mito 7cyto 7cyto_mito 7, extr 4, cyto_nucl 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MIPTLRVEAIDLALIGAYPPFCLLKDDTLSVLLLFSLSGFIVVHFRIGSTLEGMLLLRVVWHGVVYVKRRTKRKDRIMHAKGKNHIPRRTGRRMSLGELKENDWTMLSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.04
6 0.05
7 0.06
8 0.07
9 0.1
10 0.11
11 0.15
12 0.17
13 0.18
14 0.18
15 0.18
16 0.18
17 0.15
18 0.13
19 0.09
20 0.06
21 0.05
22 0.04
23 0.04
24 0.03
25 0.03
26 0.03
27 0.04
28 0.05
29 0.05
30 0.06
31 0.05
32 0.06
33 0.06
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.06
40 0.06
41 0.05
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.05
51 0.09
52 0.13
53 0.21
54 0.28
55 0.34
56 0.42
57 0.5
58 0.59
59 0.66
60 0.73
61 0.75
62 0.78
63 0.84
64 0.85
65 0.87
66 0.84
67 0.81
68 0.75
69 0.75
70 0.75
71 0.72
72 0.7
73 0.65
74 0.67
75 0.69
76 0.74
77 0.71
78 0.66
79 0.66
80 0.63
81 0.64
82 0.64
83 0.58
84 0.54
85 0.5
86 0.47
87 0.42
88 0.39
89 0.33
90 0.25