Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2X3H1

Protein Details
Accession A0A1Y2X3H1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAPQTKKSGKQAKTTKKFVIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, nucl 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPQTKKSGKQAKTTKKFVINAQQPASDKIFDTAAFEKFLQDKIKVEGRTGNLGDTIVIQQAGEGKIEIIAHNELSGRYLKYLTKKFLKKMQLRDWLRVVSTSKGVYELKFFNVVNDEADEDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.76
4 0.73
5 0.7
6 0.7
7 0.67
8 0.65
9 0.6
10 0.57
11 0.5
12 0.5
13 0.45
14 0.35
15 0.27
16 0.21
17 0.2
18 0.15
19 0.18
20 0.17
21 0.15
22 0.17
23 0.16
24 0.17
25 0.17
26 0.2
27 0.19
28 0.18
29 0.18
30 0.2
31 0.26
32 0.25
33 0.25
34 0.26
35 0.25
36 0.28
37 0.27
38 0.23
39 0.17
40 0.16
41 0.15
42 0.12
43 0.1
44 0.06
45 0.05
46 0.05
47 0.04
48 0.06
49 0.07
50 0.06
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.1
64 0.08
65 0.08
66 0.1
67 0.13
68 0.21
69 0.26
70 0.31
71 0.39
72 0.44
73 0.48
74 0.55
75 0.62
76 0.62
77 0.67
78 0.7
79 0.71
80 0.69
81 0.7
82 0.66
83 0.57
84 0.5
85 0.44
86 0.37
87 0.29
88 0.29
89 0.24
90 0.2
91 0.22
92 0.23
93 0.2
94 0.23
95 0.22
96 0.21
97 0.25
98 0.24
99 0.23
100 0.25
101 0.25
102 0.22
103 0.21
104 0.2