Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179IGR8

Protein Details
Accession A0A179IGR8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-90DARRIHRRPLRRGLRSRPGRHGPBasic
NLS Segment(s)
PositionSequence
70-88RRIHRRPLRRGLRSRPGRH
Subcellular Location(s) extr 16, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036908  RlpA-like_sf  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MQFSVLAAAAMAAIAHAVHATYFTPNGHAGACGWGINNEAWAIALSPHAWDNGAHCGTGHQDPAQRQDARRIHRRPLRRGLRSRPGRHGPGLLPAVCPPSEGDIVVDWWY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.05
8 0.06
9 0.08
10 0.08
11 0.1
12 0.11
13 0.12
14 0.11
15 0.11
16 0.1
17 0.1
18 0.11
19 0.09
20 0.08
21 0.08
22 0.09
23 0.09
24 0.09
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.04
31 0.05
32 0.04
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.12
40 0.12
41 0.11
42 0.11
43 0.11
44 0.13
45 0.14
46 0.13
47 0.09
48 0.12
49 0.14
50 0.19
51 0.25
52 0.25
53 0.25
54 0.34
55 0.39
56 0.43
57 0.51
58 0.51
59 0.54
60 0.59
61 0.68
62 0.67
63 0.71
64 0.75
65 0.75
66 0.8
67 0.8
68 0.83
69 0.84
70 0.82
71 0.81
72 0.78
73 0.73
74 0.67
75 0.62
76 0.52
77 0.49
78 0.48
79 0.39
80 0.32
81 0.28
82 0.29
83 0.24
84 0.24
85 0.17
86 0.17
87 0.17
88 0.16
89 0.16
90 0.14