Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179ISP4

Protein Details
Accession A0A179ISP4   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
181-211LQHLKGGHPGRRRDKKRKGPKGPRRDKVSGGBasic
NLS Segment(s)
PositionSequence
185-218KGGHPGRRRDKKRKGPKGPRRDKVSGGVRKRSRD
Subcellular Location(s) nucl 13.5, cyto_nucl 13, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MSDTEVETKIPPSSQSHFAKFEEFTPDDAAPFEDEFKRLAASQEWIPGSQQYTTERTIAMRAEIKTHYFSSSQLPAAEAPDSSRFLLVTEEDELAGYQALCDEVGLPCYDTVPECKRNLKKTLVNIIDLIDVRRVIDLRTTPQRVKIWKDFEAFRDYTLQDEHRIDIRAAKEDGGYLASLLQHLKGGHPGRRRDKKRKGPKGPRRDKVSGGVRKRSRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.42
4 0.44
5 0.45
6 0.45
7 0.41
8 0.38
9 0.37
10 0.32
11 0.29
12 0.29
13 0.28
14 0.24
15 0.24
16 0.22
17 0.16
18 0.15
19 0.17
20 0.14
21 0.15
22 0.15
23 0.15
24 0.15
25 0.14
26 0.15
27 0.14
28 0.16
29 0.17
30 0.22
31 0.22
32 0.21
33 0.21
34 0.21
35 0.21
36 0.18
37 0.19
38 0.16
39 0.19
40 0.2
41 0.2
42 0.19
43 0.18
44 0.2
45 0.18
46 0.17
47 0.18
48 0.17
49 0.2
50 0.21
51 0.22
52 0.23
53 0.23
54 0.22
55 0.18
56 0.19
57 0.2
58 0.21
59 0.2
60 0.18
61 0.18
62 0.16
63 0.16
64 0.16
65 0.11
66 0.1
67 0.11
68 0.12
69 0.12
70 0.11
71 0.1
72 0.1
73 0.11
74 0.09
75 0.09
76 0.09
77 0.08
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.05
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.09
99 0.14
100 0.18
101 0.2
102 0.28
103 0.33
104 0.39
105 0.44
106 0.46
107 0.46
108 0.48
109 0.55
110 0.49
111 0.44
112 0.39
113 0.35
114 0.3
115 0.25
116 0.2
117 0.11
118 0.09
119 0.08
120 0.09
121 0.08
122 0.07
123 0.1
124 0.11
125 0.15
126 0.23
127 0.28
128 0.28
129 0.34
130 0.39
131 0.4
132 0.46
133 0.49
134 0.47
135 0.47
136 0.5
137 0.46
138 0.44
139 0.46
140 0.39
141 0.32
142 0.3
143 0.25
144 0.23
145 0.24
146 0.22
147 0.2
148 0.21
149 0.21
150 0.2
151 0.22
152 0.21
153 0.23
154 0.23
155 0.23
156 0.23
157 0.22
158 0.19
159 0.18
160 0.18
161 0.14
162 0.12
163 0.08
164 0.08
165 0.07
166 0.08
167 0.08
168 0.08
169 0.09
170 0.1
171 0.11
172 0.18
173 0.24
174 0.3
175 0.37
176 0.47
177 0.55
178 0.66
179 0.76
180 0.79
181 0.84
182 0.89
183 0.92
184 0.94
185 0.95
186 0.95
187 0.96
188 0.96
189 0.96
190 0.94
191 0.92
192 0.86
193 0.8
194 0.78
195 0.78
196 0.76
197 0.74
198 0.75