Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179ISH1

Protein Details
Accession A0A179ISH1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-67DKRSNRADGKTQKRRGPKPDSKPALTRRBasic
NLS Segment(s)
PositionSequence
44-67NRADGKTQKRRGPKPDSKPALTRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MSASLSPEQYSSHQSQSPGDGSEGKSPVGLNLDFFKNLNDKRSNRADGKTQKRRGPKPDSKPALTRRQELNRQAQRTHRERKELYIKALEDEVLRLKEIYSSVTRDREKLAEENRLLKDTLVRNGINVPSGSNGRDDNNNNPSAGSTGFGGSQGGFSPSQAASQGSAPSAGGSYSNQSQFRGNQFSSASPVNLPATKLDVEQAGIDFVLALEKPCMAHLPFLMDRGSGAEGEPCGHALMASCPPVPFKDIPKSTPFAGTDGTAINQEEAPSQGTWQVTKADLSTLLDLSKRLDLDGEITPVMAWGMIMSHPQFAALSAADVQRIAEELGRKVRCYGFGAVMEHFELRDAFESVYSNRMEQMAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.37
4 0.36
5 0.31
6 0.29
7 0.28
8 0.28
9 0.33
10 0.32
11 0.27
12 0.26
13 0.24
14 0.24
15 0.24
16 0.21
17 0.16
18 0.19
19 0.22
20 0.22
21 0.22
22 0.23
23 0.27
24 0.3
25 0.36
26 0.4
27 0.4
28 0.47
29 0.56
30 0.6
31 0.58
32 0.59
33 0.61
34 0.63
35 0.72
36 0.75
37 0.74
38 0.74
39 0.79
40 0.83
41 0.83
42 0.84
43 0.83
44 0.82
45 0.85
46 0.85
47 0.8
48 0.81
49 0.79
50 0.79
51 0.74
52 0.7
53 0.68
54 0.69
55 0.73
56 0.72
57 0.74
58 0.72
59 0.72
60 0.69
61 0.69
62 0.69
63 0.69
64 0.72
65 0.67
66 0.67
67 0.65
68 0.69
69 0.72
70 0.67
71 0.63
72 0.59
73 0.53
74 0.46
75 0.44
76 0.36
77 0.26
78 0.23
79 0.21
80 0.15
81 0.14
82 0.13
83 0.12
84 0.13
85 0.13
86 0.15
87 0.14
88 0.18
89 0.21
90 0.29
91 0.3
92 0.3
93 0.32
94 0.3
95 0.31
96 0.33
97 0.33
98 0.35
99 0.35
100 0.41
101 0.4
102 0.39
103 0.36
104 0.3
105 0.31
106 0.26
107 0.28
108 0.26
109 0.24
110 0.23
111 0.26
112 0.26
113 0.22
114 0.18
115 0.15
116 0.12
117 0.13
118 0.13
119 0.12
120 0.13
121 0.13
122 0.18
123 0.2
124 0.24
125 0.28
126 0.29
127 0.27
128 0.26
129 0.25
130 0.2
131 0.18
132 0.12
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.06
139 0.06
140 0.06
141 0.07
142 0.06
143 0.06
144 0.08
145 0.08
146 0.08
147 0.09
148 0.09
149 0.08
150 0.09
151 0.1
152 0.08
153 0.08
154 0.07
155 0.07
156 0.06
157 0.05
158 0.05
159 0.05
160 0.07
161 0.09
162 0.13
163 0.13
164 0.14
165 0.16
166 0.18
167 0.21
168 0.25
169 0.22
170 0.21
171 0.21
172 0.21
173 0.22
174 0.2
175 0.16
176 0.11
177 0.13
178 0.12
179 0.11
180 0.11
181 0.09
182 0.11
183 0.11
184 0.11
185 0.1
186 0.09
187 0.09
188 0.08
189 0.08
190 0.06
191 0.05
192 0.05
193 0.04
194 0.03
195 0.04
196 0.03
197 0.04
198 0.04
199 0.04
200 0.04
201 0.05
202 0.07
203 0.07
204 0.08
205 0.08
206 0.13
207 0.14
208 0.15
209 0.15
210 0.13
211 0.13
212 0.13
213 0.13
214 0.08
215 0.07
216 0.07
217 0.07
218 0.08
219 0.08
220 0.07
221 0.07
222 0.06
223 0.06
224 0.06
225 0.08
226 0.1
227 0.11
228 0.11
229 0.11
230 0.13
231 0.13
232 0.17
233 0.17
234 0.2
235 0.28
236 0.31
237 0.34
238 0.38
239 0.4
240 0.37
241 0.39
242 0.34
243 0.26
244 0.24
245 0.21
246 0.18
247 0.16
248 0.15
249 0.11
250 0.11
251 0.1
252 0.09
253 0.09
254 0.09
255 0.09
256 0.11
257 0.09
258 0.1
259 0.12
260 0.13
261 0.13
262 0.14
263 0.14
264 0.13
265 0.14
266 0.14
267 0.12
268 0.12
269 0.14
270 0.14
271 0.13
272 0.13
273 0.13
274 0.13
275 0.14
276 0.15
277 0.13
278 0.12
279 0.12
280 0.11
281 0.14
282 0.16
283 0.16
284 0.13
285 0.13
286 0.12
287 0.11
288 0.11
289 0.07
290 0.05
291 0.03
292 0.04
293 0.05
294 0.07
295 0.08
296 0.09
297 0.09
298 0.1
299 0.1
300 0.1
301 0.11
302 0.08
303 0.09
304 0.1
305 0.11
306 0.11
307 0.11
308 0.11
309 0.09
310 0.1
311 0.09
312 0.1
313 0.13
314 0.17
315 0.26
316 0.28
317 0.28
318 0.32
319 0.33
320 0.34
321 0.35
322 0.35
323 0.31
324 0.33
325 0.35
326 0.32
327 0.31
328 0.29
329 0.25
330 0.21
331 0.17
332 0.13
333 0.12
334 0.13
335 0.13
336 0.12
337 0.13
338 0.16
339 0.16
340 0.21
341 0.2
342 0.18
343 0.19