Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179IPT5

Protein Details
Accession A0A179IPT5   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20GKLRGRRHRQRRGPLVVFNPBasic
119-139ATTKRAGVQKKNPLRNKQVMLHydrophilic
NLS Segment(s)
PositionSequence
5-10GRRHRQ
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025755  Ribos_L4_C_dom  
IPR002136  Ribosomal_L4/L1e  
IPR023574  Ribosomal_L4_dom_sf  
IPR045240  Ribosomal_L4_euk/arch  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF14374  Ribos_L4_asso_C  
PF00573  Ribosomal_L4  
Amino Acid Sequences GKLRGRRHRQRRGPLVVFNPDADGKDLVRGFRNIPGVETCPVSALNLLQLAPGGHLGRFVVWTSSAFKALDDIYGSTTEASSHKRDFFVPSNVVSQSDLSRLINSSEIQSSLNAPKGDATTKRAGVQKKNPLRNKQVMLRLNPYAKVFSQESQKKQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.79
3 0.75
4 0.66
5 0.55
6 0.48
7 0.38
8 0.33
9 0.28
10 0.22
11 0.16
12 0.19
13 0.2
14 0.19
15 0.21
16 0.22
17 0.21
18 0.25
19 0.29
20 0.24
21 0.25
22 0.26
23 0.25
24 0.25
25 0.24
26 0.2
27 0.16
28 0.15
29 0.14
30 0.11
31 0.09
32 0.08
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.06
39 0.08
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.07
50 0.1
51 0.11
52 0.12
53 0.12
54 0.11
55 0.12
56 0.11
57 0.11
58 0.08
59 0.08
60 0.07
61 0.07
62 0.08
63 0.06
64 0.06
65 0.07
66 0.07
67 0.1
68 0.12
69 0.14
70 0.15
71 0.16
72 0.17
73 0.21
74 0.24
75 0.26
76 0.24
77 0.24
78 0.25
79 0.24
80 0.24
81 0.19
82 0.16
83 0.12
84 0.12
85 0.12
86 0.1
87 0.1
88 0.1
89 0.1
90 0.11
91 0.11
92 0.11
93 0.11
94 0.11
95 0.11
96 0.11
97 0.13
98 0.14
99 0.19
100 0.17
101 0.16
102 0.17
103 0.18
104 0.23
105 0.22
106 0.25
107 0.26
108 0.28
109 0.32
110 0.37
111 0.41
112 0.46
113 0.53
114 0.58
115 0.63
116 0.71
117 0.76
118 0.79
119 0.82
120 0.81
121 0.79
122 0.76
123 0.76
124 0.73
125 0.69
126 0.66
127 0.64
128 0.58
129 0.55
130 0.48
131 0.42
132 0.36
133 0.35
134 0.33
135 0.3
136 0.37
137 0.43